SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007626 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007626
Domain Number 1 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 9.03e-37
Family Second domain of FERM 0.0000448
Further Details:      
 
Domain Number 2 Region: 204-350
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-36
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 9-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-19
Family First domain of FERM 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007626   Gene: ENSFCAG00000008228   Transcript: ENSFCAT00000008231
Sequence length 684
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:171805435:172054241:-1 gene:ENSFCAG00000008228 transcript:ENSFCAT00000008231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCFCAVPEEFYCEVLLLNESKLTLTTQQQGIKKSTKGSVVLDHVFRHINLVEIDYFGLR
YCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVK
QDVLQGRLPCPVNIAAQLGAYAIQSELGDYDPYKHTAGYMSEYRFVPDQKEELEEAIERI
HKTLMGQAPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVG
KYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPEN
ESNSLSRKLSKFGSMSYKHRYSGRTALQMSRDLSIQLPRPDQNVARSRSKTYPKRIAQTQ
PAGSNSVNRVTGNMEHGENEGTTQITAPSPIKSFKKAKNENSPDIQRNKSHPPWEENGPQ
SGLYNSPSDRMKSPKFPSSRRRNPSCGSDDSVQPTRRRKAHNSGEDSDLKQRRRSRSRCN
TSSGSESENSNREHRKKRNRIRQENDMVDSAPQWEAVLRRQKEKNQADPNNRRSRHRSRS
RSPDIQAKEELWKHIQKELVDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQYR
RSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQGSGGSTVHQRRNGSKDSLIEEKSQTS
TSNLTGKHIAKTVKTVQASRLKMD
Download sequence
Identical sequences ENSFCAP00000007626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]