SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007757 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007757
Domain Number 1 Region: 738-914
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.27e-48
Family Chaperone J-domain 0.0000000114
Further Details:      
 
Domain Number 2 Region: 228-366
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.89e-26
Family PLC-like (P variant) 0.0049
Further Details:      
 
Domain Number 3 Region: 63-166
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.09e-16
Family Dual specificity phosphatase-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007757   Gene: ENSFCAG00000008367   Transcript: ENSFCAT00000008369
Sequence length 914
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:53048738:53097227:1 gene:ENSFCAG00000008367 transcript:ENSFCAT00000008369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSNPESAGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYT
KGDLDFTYVTSRIIVMSFPLDNVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAK
FHSRVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLHSSVNFRVYFFFFFL
LCDYLMIFSLLLESQLAKRGGKVWFSSEHTLYLGYMCDLLADKPYRPHFKPLTIKSITVS
PVPFFNKQRNGCRPYCDVLIGETKIYTTCADFERMKEYRVQDGKIFIPLSITVQGDVVVS
MYHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLETTVLKFTKPELDACDVPEKYPQLFQV
TLDIELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQETLVLGGQAPIDIPPDNPRH
FGQGGFFSSLCWQDQKSEKSFCEEDHAALVNPESEQSDDELLTLSSPHGNASGDKQHGAK
KPSKKQQEPAAPPPPEDVDLLGLEGSAVSKNFSPPVAPPTNSELLSDLFGGGGAAGAAQA
GQSGVEDMFHPSGPASTQSTPRRSAPSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSF
LTTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHTKPGSFGMGSKSAATSP
TGSSHGTPTHQNKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFAPLSSPQKASPQPMG
GGWQQGGGYNWQQTQSKPQPSMPHSSPQNRPNYNVSFSAVPGGQNERGKGSANLEGKQKA
ADFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLST
MHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELND
AWSEFENQGQKPLY
Download sequence
Identical sequences ENSFCAP00000007757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]