SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007788 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007788
Domain Number 1 Region: 140-287,326-341,420-462
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.83e-54
Family Hemopexin-like domain 0.00059
Further Details:      
 
Domain Number 2 Region: 21-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000235
Family Somatomedin B domain 0.0000697
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007788   Gene: ENSFCAG00000008399   Transcript: ENSFCAT00000008401
Sequence length 468
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:17868491:17871350:1 gene:ENSFCAG00000008399 transcript:ENSFCAT00000008401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRPLLILALLAWVVLADRESCKGRCTEGFNADRKCQCDELCSYYQSCCEDYVAECKP
QVTRGDVFTLPEDEYGVYNYFEETRDNSSVLPQPESTSQGPDLQAQTEVSPDQETFEEPL
LNPTQETLGPETSDQDIPESPVVEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEEAVS
PGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFQGHQYWRFEDGVLDPDYPRNISEGFKG
IPDNVDAALALPAHSYSGRERAYFFKGRQYWEYEFQQQPSQEECEGSSLSAVFEHFALLQ
RDSWETLFEFLFGNRFSGGAGQPRLISRDWPGVPRQVDAAMAGRIYISGSAPQSWAEKQK
SRRRNRKRYRSRRNRGRGRSQNPHRQSRSAWLSWLSSEEDSLGIYNFRDYDMDWLVPATC
EPIQSVYFFSGDKYYRVNLRTRQVDTVSPPYPRSIAQYWLGCPAPGHQ
Download sequence
Identical sequences M3W9I5
ENSFCAP00000007788 XP_003996546.1.62641 9685.ENSFCAP00000007788 ENSFCAP00000007788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]