SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007868 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007868
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily RING/U-box 0.00000299
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000007868
Domain Number - Region: 68-157
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0157
Family SIAH, seven in absentia homolog 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007868   Gene: ENSFCAG00000008487   Transcript: ENSFCAT00000008489
Sequence length 206
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:62801965:62806462:-1 gene:ENSFCAG00000008487 transcript:ENSFCAT00000008489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACQGCLGSAHRRAAVGSVGFRFCGECLQPCLQVPSPLCPLCRLPFDPKKVDKAAHVEKQL
SSYKAPCRGCNKKVTLAKMRVHVSSCMKVQEQMANCPKFVPVVPTSQPIPSAVPNRSTFT
CPYCGARNLDQQELLKHCVDNHRSDPNRVVCPICSAMPWGDPSYKSANFLQHLLHRHKFS
YDTFVDYSIDEEAAFQAALALSLSEN
Download sequence
Identical sequences ENSFCAP00000007868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]