SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007930 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007930
Domain Number 1 Region: 493-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-59
Family Eukaryotic proteases 0.00000000539
Further Details:      
 
Domain Number 2 Region: 113-207
Classification Level Classification E-value
Superfamily Kringle-like 1.74e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 208-292
Classification Level Classification E-value
Superfamily Kringle-like 1.79e-33
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 4 Region: 300-383
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-31
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 5 Region: 379-475
Classification Level Classification E-value
Superfamily Kringle-like 2.05e-28
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 34-123
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.14e-21
Family Hairpin loop containing domain 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007930   Gene: ENSFCAG00000008554   Transcript: ENSFCAT00000008555
Sequence length 728
Comment pep:known chromosome:Felis_catus_6.2:A2:86537249:86612824:-1 gene:ENSFCAG00000008554 transcript:ENSFCAT00000008555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPVLLLQHVLLHLLLLPIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIKTK
KMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMTSGVKKEFGHEFDLYENK
DYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRG
EEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDRQTPHR
HKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDVPMET
TECIQGQGEGYRGTINSIWNGVPCQRWDSQYPHQHDITPENFKCKDLRENFCRNPDGAES
PWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWEKNMEDL
HRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDH
PVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRNKD
LKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTIDLP
NYGCTIPEKTTCSVYGWGYTGSINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEICAG
AENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKIPQS
Download sequence
Identical sequences Q9BH09
NP_001009830.1.62641 XP_014928482.1.86478 XP_019306845.1.44245 XP_019306846.1.44245 XP_019670471.1.62641 ENSFCAP00000007930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]