SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008104 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008104
Domain Number 1 Region: 698-757
Classification Level Classification E-value
Superfamily R3H domain 0.00000000000182
Family R3H domain 0.0028
Further Details:      
 
Domain Number 2 Region: 431-510
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000038
Family Double-stranded RNA-binding domain (dsRBD) 0.0074
Further Details:      
 
Domain Number 3 Region: 534-611
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000447
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000008104
Domain Number - Region: 263-284
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00445
Family Formin homology 2 domain (FH2 domain) 0.051
Further Details:      
 
Domain Number - Region: 285-370
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00678
Family Double-stranded RNA-binding domain (dsRBD) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008104   Gene: ENSFCAG00000008742   Transcript: ENSFCAT00000008744
Sequence length 784
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:96902339:96918574:-1 gene:ENSFCAG00000008742 transcript:ENSFCAT00000008744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGRLLLGGDFLSPPPLPPLPPPPLPPLPPPPPEPVLEQWRYSHESDWQWALRRSFICR
HLHSYPGAALDQLLALSAAWTNHVFLGCRYSPRLMEKILQMAEGIDIGEMPSYDLMLSKP
SKGQKRHLSTCDGQNPPKKQAGSKFHARPRFEPVHFVASSSKDERQEDPYGPQTKEVNEQ
THFASMPRDIYQDYTQDSFSIQDGNSQYCDSSGFIFTKDQPVTANMYFDSGNPAPSSTSQ
QANSQSAPEPSPSQTFPESVVAEKQYFIEKLTATIWKNLSNPEMTSGSDKINYTYMLTRC
IQACKTNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLTTGYAGSKNGSRDRA
TELAVKLLQKRIEVRVVRRKFKHTIGEDLVVCQIGMPSYEFPPALKPPEELVVLAKDASG
QPIFNASAKHWTNFVLTENANDAIGILNNSASYNKMSVEYKYEMMPNRTWRCRVFLQDHC
LAEGYGTKKTSKHAAADEALKILQKTQPTYPSVKSSQCQTGSSPRGSGKKKDIKDLVVYE
NSSNPVCTLNDTAQFNRMTVEYVYERMTGLRWKCKVILESEVIAEAVGVKKTVKYEAAGE
AVKTLKKTQPTVINNLKKGAIEDVISRNEIQGRSAEEAYKQQIKEDNIGNQLLRKMGWTG
GGLGKSGEGIREPISVKEQHKREGLGLDVERVNKIAKRDIEQIIRNYARSESHTDLTFST
ELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVM
PQAN
Download sequence
Identical sequences M3WA55
ENSFCAP00000008104 XP_004000877.2.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]