SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008109 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008109
Domain Number 1 Region: 900-1177
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.49e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000144
Further Details:      
 
Domain Number 2 Region: 418-598
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000131
Family Fibronectin type III 0.0071
Further Details:      
 
Domain Number 3 Region: 705-794
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000141
Family Fibronectin type III 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000008109
Domain Number - Region: 615-694
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000178
Family Fibronectin type III 0.0084
Further Details:      
 
Domain Number - Region: 14-106
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0214
Family Fibronectin type III 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008109   Gene: ENSFCAG00000008747   Transcript: ENSFCAT00000008749
Sequence length 1199
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:51279036:51385000:1 gene:ENSFCAG00000008747 transcript:ENSFCAT00000008749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLWKFSARQNATTFRVTVQDDNSIVVSLEASDVTSPSSVYVVKITGESKNYFFEFEEFNG
TLPPPVTFKANYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETG
VLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGICYSNITFQLVS
EATFNKSTLVEYSGVSHEPKQHRTAPYPPRNISVRIVNSNKNNWEEQSGSFPEESFMRSQ
DTMGKDKLFRFTDETPEMPSGNISSGWPDFNSSDYETTSQPYWWGSASTAPESEDDFVSV
LPVEYEHNSTLSDTEKSTSGPFSFFPVQMILNWLPPKPPTAFDGFHIHIEREENFTEYLT
VDEEAHEFVAELKEPGYKLSVTTFSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQ
HVSVHVLSSTTALMSWTSSQENYNGTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKSIIE
NLVPGAQYQVVMYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWSRPYLGV
FRKYVVEMFYFNPATMTSEWTTYYEIAATISLTASVRIANLLPAWYYNFRVTMVTWGDPE
LSCCDSSTISFITAPVAPEITSVEYFNSLVYISWTYGDDTTDLSHSRMLHWMVVAEGKKK
IKKSVTRNVMTAILSLPPGDIYNLSVTACTERGSNTSMLRLVKLEPAPPKSLFAVNKTQT
SVTLLWVEEGVADFFEVFCQQVGSSQETKLQEPISVSSHVVTISSLLPATAYNCSVTSFS
HDSPSVPTFIAVSTMVTEMNPNVVVISVLAILSTLLIGLLLVTLIILRKKHLQMARECGA
GTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFYINPWSKNGLKKRKLTNP
VQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFS
RVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLT
QCNEKRRVKCDHYWPFTEEPIAYGDITVEMMSEEEREDWACRHFRINYADEMQDVMHFNY
TAWPDHGVPTANAAESILQFVHVVRQQATKSKGPMIVHCSAGVGRTGTFIALDRLLQHIR
DHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWTKKKQQFCISDVIYENVSKS
Download sequence
Identical sequences ENSFCAP00000008109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]