SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008131 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008131
Domain Number 1 Region: 3334-3443,3728-3766,3835-3897,3924-4017,4143-4283,4555-4609
Classification Level Classification E-value
Superfamily ARM repeat 0.000000494
Family HspBP1 domain 0.076
Further Details:      
 
Domain Number 2 Region: 1890-2011
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000011
Family WD40-repeat 0.031
Further Details:      
 
Domain Number 3 Region: 594-626,720-844,985-1023,1075-1174,1218-1396,1427-1596
Classification Level Classification E-value
Superfamily ARM repeat 0.0000998
Family MIF4G domain-like 0.084
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000008131
Domain Number - Region: 550-558
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0214
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008131   Gene: ENSFCAG00000008769   Transcript: ENSFCAT00000008771
Sequence length 5126
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:12990142:13114838:-1 gene:ENSFCAG00000008769 transcript:ENSFCAT00000008771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SESEILHHEKQYEPFYSSFVALSTHYITTVCSLIPRNQLQSVAAACKVLIEFSLLRLENP
DEACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELAS
PVSPELRQKEVQMNFLNQLTSVFNPRTVASPPVGPQTPAEGENDEQSSTDQASAVKTKNV
FIAQNVASLQELGGSEKLLRVCLNLPYFLRYINRFQDAVLANSFFIMPATVADATAVRNG
FHSLVIDVTMALDTLSLPVLEPLNPSRLQDVTVLSLSCLYAGVSVATCMAILHVGSAQQV
RTGSTSSKEDDYESDAATIVQKCLEIYDMIGQAISNSRRAGGEHYQNFQLLGAWCLLNSL
FLILNLSPTALADKGKEKDPLAALRVRDILSRTKEGVGSPKLGPGKGHQGFGVLSVILAN
HAVTLLTSLFQDLQVEALHKGWETDGSPAVLSIMAQSTSIQRIQRLIDSVPLTNLLLTLL
STSYRKACVLQRQRKGSMSSDASASTDSNTYYEDDFSSTEEDSSQDDDSEPILGQWFEET
ISPSKEKVAPPPPPPPPPLESSPRVKSPSKQAPGEKGNILASRKDPELFLGLASNILNFI
TSSMLNSRNNFIRNYLSVSLSEHHMATLASIIKEVDKDGLKGSSDEEFAAALYHFNHSLV
TSDLQSPNLQNTLLQQLGVAPFSEGPWPLYIHPQSLSVLSRLLLIWQHKAGAQGDPDVPE
CLKVWDRFLSTMKQSALQGVVPSETEDLNVEHLQLLLLIFHNFTEKGRRAILTLFVQIIQ
ELSASVEAQARSVPLILARLLLIFDYLLHQYSKAPVYLFEQVQHNLLSPPFGWASGSQDS
NSRRATAPLYHGFKEVEENWSKHFSSDAVPQPRFYCVLSPEASEDDLNRLDSVACDVLFS
KLVKYDELYTALTSLLAAGSQLDTVRRKENKNVTALEACALQYYFLILWRILGILPPSKT
YMNQLAMNSPEMSECDILHTLRWSSRLRISSYVNWIKDHLIKQGMKAEHASSLLELASTK
CSSVKYDVEIVEEYFARQISSFCSIDCTTILQLHEIPSLQSIYTLDAAISKVQVSLDEHF
SKMAAETDPHKSSEVTKNLLPATLQLIDTYASFIRAYLLQNFNEEGSTEKPSQEKLHGFA
AVLAIGSSRCKANTLGPTLVQNLPSWVQAVCESWNNINTNEFPNIGSWRNAFANDTIPSE
SYISAVQAAHLGTLCGQSLPLAASLKHTLLSLVRLTGDLIVWSDEMNPPQVIRTLLPLLL
ESSTESVAEISSNSLERILGPAESDEFLARVYEKLITGCYNILANHADPNSGLDESILEE
CLQYLEKQLESSQARKAMEEFFSDGGELVQIMMATANENLSAKFCNRVLRFFTKLFQLTE
KNPNPSLLHLCGSLAQLACVEPVRLQAWLTRMTASPPKDSDQLDVIQENRQLLQLLTTYI
VRENSQVGEGVCAVLLGTLIPMATEMLANGDGTGFPELMVVMATLASAGQGAGHLQLHNA
AVDWLSRCKKYLSQKNVVEKLNANVMHGKHVIVLECTCHIMSYLADVTNALSQSNGQGPS
HLSVDGEERAIEVDSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHC
HTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSST
MKESAFQSEPRVSESLVRHTSTSPADKAKVTISDGKVADEDKPKKSSLCRTVEGCREELQ
NQANFSFAPLVLDMLSFLMDAIQTNFQQASAVGSSSRAQQALRELHTVDKVVEMTDQLMV
PTLGSQEGAFENVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQHLAVSHEKGK
ITVLQLSALLKQADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTF
SSSGSVSDHLVLHPQLATGNFIIKAVWLPGSQTELAIVTADFVKIYDLSVDALSPTFYFL
LPSSKIRDVTFLFNEEGKNIIVIMSSAGYIYTQLMEEASSAQQGPFYVTNVLEINHEDLK
DSNSQVAGGGVSVYYSHVLQMLFFSYCQGKSFAATISRTTLEVLQLFSINIKSSNGGSKT
SPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPDTFLIQEIKTLPAKAKIQDMVAIRHT
ACNEQQRTTMILLCEDGSLRIYMASVESTSYWLQPSLQPSSVVSIMKPVRKRKTATITTR
TSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEI
SNNNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADKK
LNLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEEFPSASVSNICPSNLNQSNGTG
DSDSAAPATTSGTVLERLVVSSLEALESCFAVGPIIEKERNKNAAQELATLLLSLPAPAS
VQQQSKSLLASLHTSRSAYHSHKDQALLSKAVQCLNTSSKEGKDLDPEVFQRLVITARSI
AIMRPNNLVHFTESKLPPMETEGADEGRDPQKQLEGDCCSFITQLVNHFWKLHASKPKNA
FLAPACLPGLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQMLLCPPQDPAVSFSCK
QALIRVLRPRNKRRHVTLPSSPRSNTPMGDKDDDDDDDADEKMQSSGIPNAGHIRQESQE
QSEVDHGDFEMVSESMVLETAENVNNGNPSPLEALLAGAEGFPPMLDIPPDADDETMVEL
AIALSLQQDQQGSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTASAPASDDEGSTAATD
GSTLRTSPAEHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATVEGHPAGPGSVSSSTG
AISTTTGHQEGDGSEGEGEGEGEGDVHTSNRLHMVRLMLLERLLQTLPQLRNVGGVRAIP
YMQVILMLTTDLDGEDEKDKGALDNLLSQLIAELGMDKKDVSRKNERSALNEVHLVVMRL
LSVFMSRTKSGSKSSICESSSLISSATAAALLSSGAVDYCLHVLRSLLDYWKSQQNDEEP
VATSQLLKPHTTSSPPDMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKIADAN
SRIPPPVFDHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVR
GIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTVNWQKFCIKDD
SVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAALAASAGSSTASSSSAPVAASSGQ
ATTQSKSSTKKSKKEEKEKEKEGESSGSQEDQLCTALVNQLNKFADKETLVQFLRCFLLE
SNSSSVRWQAHCLTLHIYRNSSKSQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLK
TPQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYSTLSGLVEFDGYYLESDPCLVCNNP
EVPFCYIKLSSIKVDTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTVNLYYNNRT
VQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETL
QCPRCSASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAK
PCCAVDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLLCKVNEAAPEKPQDD
SGTAGGISSTSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREA
ATKSSRTSVQPTFTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRH
ILVSQGLIRELFDYNLRRGSAAMREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGH
WANPDLASSLQYEMLLLTDSISKEDGCWELRLRCALSLFLMAVNIKTPVVVENITLMCLR
ILQKLIKPPAPTSKKNKDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYEAWKKCLPIR
GTDGNGKSPSKSELRHLYLTEKYVWRWKQFLSRRGKRTPPLDLKLGHNNWLRQPLSQSAT
AASGLDTCLLCESFKTTVAVRRSTVLFCRASYLDELSIAGECAAEYLALYQKLITSAHWK
VYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTGLLSSFVEVESIKRH
FKSRLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETA
KRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEP
GIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVWCTTNEGEP
MRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLNRLAGIKD
FKQGRHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESKDSGGAA
VAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLL
RIIPYLSFGEVEKMQILVERFKPYCSFDKYDEDHSGDDKVFLDCFCKIAAGIKSSSNGHQ
LKDLILQKGITQSALDYMQKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAVQHPATQ
VLIGTDSITNLHKLEQVSSDEGIGTLAENLLEALREHPDVNKKIDAARRETRAEKKRMAM
AMRQKALGTLGMTTNEKGQVVTKTALLKQMEELIEEPGLTCCICREGYKFQPTKVLGIYT
FTKRVALEEMENKPRKQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCN
GLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDMKLLFLRFAMEQSFSAD
TGGGGRESNIHLIPYIVHTVLYVLNTTRATSREEKNLQGFLEQPKEKWVESAFEVDGPHY
FTVLALHILPPEKWRATRVEILRRLLVTSQARAVAPGGATRLTDKAVKDYSAYRSSLLFW
ALVDLIYNMFKKVPTSNTEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSE
FLDAAGLLSEITDPESFLKDLLNSIP
Download sequence
Identical sequences ENSFCAP00000008131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]