SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008145 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000008145
Domain Number - Region: 105-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000889
Family Myosin rod fragments 0.025
Further Details:      
 
Domain Number - Region: 38-135
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00403
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008145   Gene: ENSFCAG00000008786   Transcript: ENSFCAT00000008786
Sequence length 214
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:14951424:15001683:-1 gene:ENSFCAG00000008786 transcript:ENSFCAT00000008786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGRGANFDGVSTDRLEKELLEEIHQKDIVQLSMLEIIHKIEELEAKLNTDDKGGEWKV
RYETQLELNDQLEKQIVSLEEKMKKICGNPSDRLSFIRVYEKMPVESLNILLKQLEKEKR
RLKNQVKDYALRLEQESKAYHKTNNECHTYLAEMSQVSDSYQVSKRQQMDQLPRMKENSV
KMVRYNPVNQKTMNAKRGPGKKITRSNHLPKLDP
Download sequence
Identical sequences A0A2I2UXQ1
XP_006927292.1.62641 ENSFCAP00000008145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]