SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008170 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008170
Domain Number 1 Region: 497-600
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-24
Family PDZ domain 0.0097
Further Details:      
 
Domain Number 2 Region: 31-127
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-23
Family PDZ domain 0.0000086
Further Details:      
 
Domain Number 3 Region: 278-389
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-18
Family PDZ domain 0.03
Further Details:      
 
Domain Number 4 Region: 770-880
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000143
Family Nucleotide and nucleoside kinases 0.0013
Further Details:      
 
Domain Number 5 Region: 601-673
Classification Level Classification E-value
Superfamily SH3-domain 0.000000326
Family SH3-domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008170   Gene: ENSFCAG00000008814   Transcript: ENSFCAT00000008816
Sequence length 1184
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:11753924:11806806:1 gene:ENSFCAG00000008814 transcript:ENSFCAT00000008816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTAQVLQRMWSQAVKKFGRLKGHAPGMEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPH
FENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKIAAIVV
KRPRKVQLAPPQGSPSVGEDDRAFDVMDEFDGRSARSGYSERSRRSSHGARSRSWEDSPE
RGRPHERARSPERERSRGRSLERGLDHDDYGRGRERSRGRSLERGLDHDDYGRARERSRG
RSTDRAYDRAYDRAYSPEEYGRRAQPDARYAASRSRSREHLHSCSPSPELRGRPDSDRPI
GVLLVKSKANEEYGLRLGSQIFIKEMTRTGLANKDGNLHEGDIILKINGTVTENMSLTDA
RKLIEKSRGKLQLVVLRDSRQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRQQYSDY
DYHSSNEKLKERPNSREDMQNRWSRMGATPTPFKSMGDAAAALGTENSKEPKYQEEPPAP
QPKAAPRTFLHPSPEDEAIYGPNTKMVRFQKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQ
EGLQEGDQILKVNTQDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDS
FFIRSHFECEKETPQSLAFTRGEVFRVVDTLYDGKLGHWLAVRIGNELEKGLIPNKSRAE
QMASVQNAQRDNAGDRADFWRMRGQRSGVKKNLRKSREDLTAVVSVSTKFPAYERVLLRE
AGFKRPVVLFGPIADIALEKLANELPDLFQTAKTEPKDAGSEKSSGVVRLNTVRQIIEQD
KHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLYDQANKL
KKTCAHLFTATINLNSANDSWFGSLKDSIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTA
MGADYLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEESIRKPS
PEPRAQMRRAASRDQLRDSSPPPAFKPEPPKAKTQNREESFDFSRSHEYKSNPSAVAGNE
IPGASTKGYPPPVAAKPALARSILKPSTPVPPPEGEEVGEGSEEQDGTPKSVLGKVKIFE
KMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGLSQNTSSRPPEPQKGP
SRLYQDPRGSYGSDVEEEEYRQQLSEHSKRGYYGQPSRYRDTEL
Download sequence
Identical sequences XP_006939139.1.62641 ENSFCAP00000008170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]