SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008201 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008201
Domain Number 1 Region: 262-314
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000329
Family Myb/SANT domain 0.0000993
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000008201
Domain Number - Region: 5-133
Classification Level Classification E-value
Superfamily BAH domain 0.00902
Family BAH domain 0.018
Further Details:      
 
Domain Number - Region: 368-408
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00998
Family Erythroid transcription factor GATA-1 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008201   Gene: ENSFCAG00000008845   Transcript: ENSFCAT00000008849
Sequence length 508
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:107520579:107658455:-1 gene:ENSFCAG00000008845 transcript:ENSFCAT00000008849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITDYVYFENSSSNPYLIRRIEELNKTATGNVEAKVVCFYRRRDISNTLIMLADKHAKEIE
EESETTIEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKE
DTFFYSLVYDPSVKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSP
LTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYD
LSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSII
EYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISASNGKPGAVNGAVGTT
FQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSEEEKL
SPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTL
RLRQAARRPFVPINYAAIRAECKMLLNS
Download sequence
Identical sequences ENSFCAP00000008201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]