SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008220 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008220
Domain Number 1 Region: 379-584
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-59
Family Nucleotide and nucleoside kinases 0.00011
Further Details:      
 
Domain Number 2 Region: 204-363
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-29
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 130-221
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.0008
Further Details:      
 
Domain Number 4 Region: 72-122
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000471
Family L27 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008220   Gene: ENSFCAG00000008868   Transcript: ENSFCAT00000008870
Sequence length 589
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:25372607:25612344:-1 gene:ENSFCAG00000008868 transcript:ENSFCAT00000008870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYY
EKQNPVPILHGAAVLADDLAEELQNKPLNSEIRELLKLLSKPNVKALLSVHDTVAQKNYD
PVLPPMPDDIDDEEDSVKIIRLVKNREPLGATIKKDEQTGAVIVARIMRGGAADRSGLIH
VGDELREVNGIPVEDKRPEEIIQILAQSQGAITFKIIPSIKEETPSKEGKMFIKALFDYD
PNEDKAIPCKEAGLSFKKGDILQIMSQDDATWWQATHEGDANPRAGLIPSRHFQERRLAL
RRPEILVQPLKVSNRKSYAEYAGSHSGTYIAGFRRSFRLSRKDKKTNKSMYECKKSDQYD
TADVPTYEEVTPYRRQTNEKYRLVVLVGPVGVGLNELKRKLLISDTQHYGVTVPHTTRAR
RSQESDGVEYIFISKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAKNKVCLLDVQ
PHTVKHLRTLEFKPYVIFIKPPSIERLRETRKNAKIISSRDDQGAAKPFTEDDFQEMIKS
AQIMESQYGHLFDKIIVNDDLTVAFNELKTTFDKLETETHWVPVSWLHS
Download sequence
Identical sequences ENSFCAP00000008220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]