SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008332 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008332
Domain Number 1 Region: 19-192
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-46
Family DBL homology domain (DH-domain) 0.0000323
Further Details:      
 
Domain Number 2 Region: 178-321
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-33
Family Pleckstrin-homology domain (PH domain) 0.00095
Further Details:      
 
Domain Number 3 Region: 341-451
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.74e-28
Family DEP domain 0.003
Further Details:      
 
Domain Number 4 Region: 436-565
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.95e-28
Family DEP domain 0.0011
Further Details:      
 
Domain Number 5 Region: 636-702
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000223
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 540-632
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000657
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008332   Gene: ENSFCAG00000008986   Transcript: ENSFCAT00000008990
Sequence length 1568
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:18114868:18338242:1 gene:ENSFCAG00000008986 transcript:ENSFCAT00000008990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAFLHRMNQCAASKIDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEV
GTCFLHFKDKFRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGY
LVTPIQRICKYPLLLKKQELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEV
LEEWQSHIEGWEGSNITDTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHSTRR
LKNSKASTDGHRYLFRGRINTEVMEVENVDDGTADFHSSGHIVINGWKIHNTAKNKWFVC
MAKTPEEKHEWFEAILKERERRKGLKLGMEQDTWVMISEQGEKLYKMMCKQGNLIKDRKR
KLTTFPKCFLGSEFVSWLLEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYR
FRYDDGTFYPRNEMQDVISKGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLI
AQGDCRTREEAMIFGVGLCDNGFMHHVLEKSEFKDEPLLFRFFADEEMEGSNMKHRLMKH
DLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAING
DLVFMRPFNEVDCFLKSCLNSRKPLRVLVSTKPRETVKIPDSAEGLGFQIRGYGPSVVHA
VGRGTVAAAAGLHPGQCIIKVNGINVSKETHASVIAHVTACRKYRRPVKQDSIQWVYNSI
ESAQEDLQKANCKPPGDEVGDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGV
VYEYDSTAGIKCNVVEKMIEPKGFFSLTAKILEALAKSDDHFVQNCTSLNSLNEVIPTDL
HNKFSAFCSEKIEHICQRISSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVN
IMEVSYPKTSTSLGSAFGVQLDSRKHNSLDKENKSEQGKLSPMVYIQHTITTMAAPSGLS
LGQQDGHGLRYLLKEEDLETQDIYQKLLGKLQTALKEVEMCVCQIDDLLSSITYSPKLER
KTSECTGPTDSDNEKGERNSKRVCFNMAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFT
SICSSQCSSYLHSDEMDSGDELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVV
RAFEQTKYLTPGQGLQEFQQEMEPKLSCPKRLRLHIKQDPWNLPSSVRNLAQNIRKFVEE
VKCRILLALLEYSDSETQLRRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKDNEMDTGE
ASRRWLDQIANAGVLFHFQSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVA
NVPLTYQAEGSRQALKVYFYIDSYHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYRD
NVSVEEFQAQINAASLEKVKQYNQKLRAFYLDKSNSPPNSTSKAAYVDKYLPNPVSLTDH
IIKIVPCFLAMKREGSVAERSVFSVSVYGMLTESWEVCKFDGLGACNISQSGAFAHRCTL
SVTLEQAIILARSHGLPPRYIMQATDVMRKQGARVQNTAKNLGIRDRTPQSAPRLYKLCE
PPPPVGEE
Download sequence
Identical sequences ENSFCAP00000008332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]