SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008368 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008368
Domain Number 1 Region: 360-593
Classification Level Classification E-value
Superfamily HCP-like 2.09e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 567-701
Classification Level Classification E-value
Superfamily HCP-like 1.01e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 200-324
Classification Level Classification E-value
Superfamily HCP-like 2.35e-24
Family HCP-like 0.0031
Further Details:      
 
Domain Number 4 Region: 117-171
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-20
Family Fibronectin type II module 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008368   Gene: ENSFCAG00000009027   Transcript: ENSFCAT00000009030
Sequence length 795
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:127178108:127231252:-1 gene:ENSFCAG00000009027 transcript:ENSFCAT00000009030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRVGLTLLLCAVLLGSASASSDEEGSQDESLDSKTPLPSDESSVKDHSTAGRVVAGQI
FLDSEESELESPIQEEEDSLRSQEAESVTEEISFLESPNPENQDYEEPSKVRKQALTAIE
GTAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQ
MQEAEVMYQTGMKILNGSNKKSQKREAYRYLQKAAGMNHTKALERVSYALLFGDYLTQNI
QAAKEMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGY
RYWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEED
LIQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKM
YSEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAE
QGWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSC
HTAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQ
REATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASE
QQHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLAVVYFLQ
YIRETNIRDLFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPLPRPPGPRP
VPPQQEGPPEQQPPQ
Download sequence
Identical sequences M3WAN5
XP_003987944.1.62641 ENSFCAP00000008368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]