SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008393 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008393
Domain Number 1 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 517-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 335-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000022
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 434-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000841
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 222-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000304
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 8 Region: 268-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000364
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008393   Gene: ENSFCAG00000009055   Transcript: ENSFCAT00000009057
Sequence length 578
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:8714933:8731124:-1 gene:ENSFCAG00000009055 transcript:ENSFCAT00000009057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRSQEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSHLVSVGYCFTKPEVVFKI
EQGEEPWILEAGFPSHCHQEDWKVDDLIESSQDNEDEHFWQLAFTANKTLNIDSGARVRK
TFNLGTDSVPSRNFPYKICDSCEMSLKNISGLIISRKSYSGKKPDEFNVYEKLLLDIRHE
KAPPGGKSYKYNQKRNVLHHSHDLSQPIFDQPSEYNENGQAFHEEAAFFTNKKIQIGETL
CKYNACGRTFIHSLELSLSQRTHLEMEPYECSLCGKSFYTDLRLGHQRTLTGETPYEYDE
YGQSFCDDSTFIIHQGTYARKIPHEYKVSHKTWEKSSLFKHQIVHMGKKPYEHHENRNNF
SKKSHLTQLRRAHSGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKSFCQKP
HLTNHQRTHTGEKPYACKQCGKTFCVKSNLTEHQRTHTGEKPYECNTCGKSFCHRSALTV
HQRTHTGEKPFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQRT
HTGEKPYECNGCGKTFSQRSVLTKHQRIHTRVKALSTS
Download sequence
Identical sequences XP_006937785.1.62641 XP_006937786.1.62641 XP_011285501.1.62641 XP_019669690.1.62641 ENSFCAP00000008393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]