SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008400 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008400
Domain Number 1 Region: 773-954
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.15e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 
Domain Number 2 Region: 929-1050
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.48e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 159-192,231-377
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-31
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 15-157
Classification Level Classification E-value
Superfamily PH domain-like 6.29e-20
Family Phosphotyrosine-binding domain (PTB) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008400   Gene: ENSFCAG00000009063   Transcript: ENSFCAT00000009064
Sequence length 1176
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:173651380:173869989:-1 gene:ENSFCAG00000009063 transcript:ENSFCAT00000009064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARRHLFPNEASVDFGLQLVGSLPVHALTTMPMLPWVVAEVRRLSGQSSKKEPG
TKQVRLCVSPSGLRCEPEPGRSQQWDPLICSSVFECKPQHVHKLIHNSHDPSYFACLIKD
NAGSQQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDETFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSCSRKAEFDLVSQDSETPVGNGEQGGRPMRKSFSQPG
LRSLAFKKEFQDGSLRSSSLFRSFEENDIENHLISGHNIVQPTDIEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICREASGGGGFHFVCYVFQCTNEALV
DEIMMTLKQAFTVAAVQQTAKTPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKVHTHVGEIKQTSQIAAENI
GSELPPSAARLRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSASLDLDSSLSSTLSN
TSKEPSGCDREAVPASDSSFRLLGSSDDLSSDSESRPAEEPAPLTPQQGFRRRANTLSHF
PVQCEEPPEPAQGSPGVAQRKLMRYHSVSTETPHERKDFDSKANHLGDVRGTPVKTRRHS
WRQQIFLRVATPQKACDSPSRYEDYSELGELPPRSPLEPVCEDGPAGPVPEERKRTSREL
RELWQKAILQQILLLRMEKENQKLQASESDLLNKRLKLDYEEITPCLKEVTTVWEKMLST
PGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQHHLKHQFPSKQQPKDTPYKELLKR
LTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL
LLHMGEEEAFHMLKFLMFEMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEI
GPSLYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENLE
TIVDFIKNTLPNLGLVQMEKTISQVFEMDISKQLQAYEVEYHVLQEELIDSSPLSDNQRM
DKLEKTNSSLRKQNLDLLEQLQVANSRIQSLEATVEKLLSSESKLKQATLALELERAALL
QVVGELRRQTATEPSGPEPDLTWPGPTGTDRTGDGS
Download sequence
Identical sequences ENSFCAP00000008400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]