SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008477 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008477
Domain Number 1 Region: 897-1193
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 3.92e-75
Family Formin homology 2 domain (FH2 domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008477   Gene: ENSFCAG00000009143   Transcript: ENSFCAT00000009144
Sequence length 1199
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:70184157:70485861:-1 gene:ENSFCAG00000009143 transcript:ENSFCAT00000009144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTHCTLQLRKPITEVCYISFYLPRGEVRGFSYKGTVTLDRSNKGFHNCYQVREGSDVI
SLSLQPNEHPGDIFFKQTPTKDILTELYKLTAERERLLANLLSSDHILGITMGSQEGKLP
ELSVSLAPEDDCFQSVGDGPGEPPVGCLNKRSAHGNKKPRRFGGRRGSFQVLPQKRTRRK
GRGGQESAPQMGKDQICSSNSLPVSRARRNLWLLEEKGNLLPSGAFTSSVQWRGSCPPEI
PGALDASGSFRKTSEGTGFGRGGLPPDCRSTEPGDDSGARVPKRGPRRLAHQQTDLSERR
EDPEQHPEAEKGRREKSGEHTCGRKPISKVVAKVQDLSTQVQRVVKTHLESEESVAICPA
AQAEFIPRADLFTLPGAEAGTQGCRWPGTEQHGDRSLQASDRERIPASAEGAVNKVLLKV
IESEKVDEATEGKRLGFPLSTPATHTLPETRSKRKAGMPLKGHKTLFLDPPPSVGPDWSQ
PGGDEKRPSPPALAALSMPLNNSSSQSCAYTRMSPVPSPPSPRLPSPRQHHRVLQLPPLP
GERQAAPDDSPGRKSSTFSGSSSADTLEPPTSAKVTETKGASSTSLGAGQPRLASGEPLE
KGLGPGKTTARPQYQSPPGISSEGFPRDCFNEQTASRDLPNRDGSAWFLGYRAGPACPFL
LHEEREKPNKSELYLDLHPDHSPTEQDDRTPGRLQAVWPPPKTKDTEEKVGLKYTEAEYQ
AAILHLKREHKEEIENLQAQFELQAFHIRGEHAAVTARLEETIENLKHEIEHRWRGGCEE
MRDACVSTDDDHPPKTYRNVCIQTDRETFLKPCEGEGKTIRSNQIIPKKLNISSXPSPPP
PLPNSPALPNSGGPPPAPTPPGLAPPPPPGLFFGVGPSSSQCPRKPAIEPSCPMKPLYWT
RIQISDKSQNATPTLWDSLEEPDIRDTSEFEYLFSKDTTQQKKKPLSETYEKKNKVKKII
KLLDGKRSQTVGILISSLHLEMKDIQQAIFNVDDSVVDLETLAALYENRAQEDELVKIRK
YYETSKEEELKLLDKPEQFLHELAQIPNFAERAQCIIFRSVFSESITSLHRKVEIITRAS
KGLLHMKSVKDILALILAFGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGINLVDYV
VKYYLRYYDQEAGTEKSIFPLPEPQDFFLASQVKFEDLIKDLRKLKRQLEGNRNCSVIM
Download sequence
Identical sequences ENSFCAP00000008477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]