SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008485 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008485
Domain Number 1 Region: 187-335
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-42
Family Dual specificity phosphatase-like 0.000000454
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.01e-28
Family Cell cycle control phosphatase, catalytic domain 0.00000922
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008485   Gene: ENSFCAG00000009151   Transcript: ENSFCAT00000009153
Sequence length 368
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:20275445:20282675:-1 gene:ENSFCAG00000009151 transcript:ENSFCAT00000009153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIETAINLAIPGLMLRRLRKGNLPI
RSIIPNHADKERFATRCKAATVLLYDEATAEWQPEPGAPASVLGLLLQKLRDDGCQAYYL
QGGFNKFQTEYSEHCETNVDSSSSPSGSPPTSVLGLGGLRISSDCSDGESDRELPSSATE
SDGSPVPSSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEF
TYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMN
LSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSSPCDNHTPSEQLYFSTPTNHNLF
PLNTLEST
Download sequence
Identical sequences A0A1S3A0C7 A6QLS1 M3WAW5
ENSFCAP00000008485 ENSEEUP00000004945 ENSTTRP00000015925 ENSFCAP00000008485 ENSTTRP00000015925 XP_003982341.3.62641 XP_007174777.1.59432 XP_007527376.1.11023 XP_019840439.1.53367 ENSEEUP00000004945 9685.ENSFCAP00000008485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]