SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008544 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008544
Domain Number 1 Region: 1451-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 2.3e-27
Family Fibronectin type III 0.00000938
Further Details:      
 
Domain Number 2 Region: 1906-2073
Classification Level Classification E-value
Superfamily Fibronectin type III 4.07e-27
Family Fibronectin type III 0.00000997
Further Details:      
 
Domain Number 3 Region: 908-1076
Classification Level Classification E-value
Superfamily Fibronectin type III 6.64e-25
Family Fibronectin type III 0.00085
Further Details:      
 
Domain Number 4 Region: 1635-1799
Classification Level Classification E-value
Superfamily Fibronectin type III 4.56e-24
Family Fibronectin type III 0.0000119
Further Details:      
 
Domain Number 5 Region: 1265-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 1.22e-21
Family Fibronectin type III 0.00000854
Further Details:      
 
Domain Number 6 Region: 726-891
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-21
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 7 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 7.71e-21
Family Fibronectin type II module 0.0000483
Further Details:      
 
Domain Number 8 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 1.48e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 9 Region: 1811-1901
Classification Level Classification E-value
Superfamily Fibronectin type III 3.3e-19
Family Fibronectin type III 0.00000426
Further Details:      
 
Domain Number 10 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 3.65e-17
Family Fibronectin type III 0.00000297
Further Details:      
 
Domain Number 11 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000107
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 12 Region: 2339-2382
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000107
Family Fibronectin type III 0.00000543
Further Details:      
 
Domain Number 15 Region: 230-273
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000131
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 16 Region: 472-511
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 17 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000288
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000628
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 19 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 20 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 2294-2337
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000419
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 22 Region: 2382-2423
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000017
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 23 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000012
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 24 Region: 1094-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000594
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 25 Region: 2208-2271
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000899
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008544   Gene: ENSFCAG00000009217   Transcript: ENSFCAT00000009220
Sequence length 2475
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:199707143:199776496:-1 gene:ENSFCAG00000009217 transcript:ENSFCAT00000009220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPRLLLLAVLSLGTAVPSTGASKSKRQAQQIIQPQTPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHAALQTTSAGSGSFTDVRTAIYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTENYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWKPKNSPRGWKEATIP
GHLNSYTIKGLTPGVVYEGQLISVQHYGHREVTRFDFTTTSTSTAVTSNTVTGETTPLSP
VVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVSIPDL
LPGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPAVDRVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTG
VPRSDKVPPPKDLQFVEVTDVKITIMWTPPQSPVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYHFKVFAVNQGRESKPLTAEQTTKLDAPTNLRFTNETDSTVIVTWTPP
RARIAGYRLTVALTRGGQPKQYNIGPSASQYPLRNLQPASEYTATLMAVKGNQQSPKATG
VFTTRQPLGSVPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIVV
SGLTPGVEYIYTISVLRDGQERDTPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESAPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITAHSFTVHWIAPRATITGYRIRHHPEHTGGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPPLIGQQSTVSDVPRDLEVIAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGADYTITVYAVTGRGDSPA
SSKPISIDYRTEIDKPAQMQVTDVQENSISVRWLPSSSPVTGYRVTTTPKNGPGPSKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSNPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLTAQWTAPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDSLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAIPANGQTPIQRTIKPDVRSYTITGLQPGMDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVP
RPRPGVTEATITGLEPGTEYTIQVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFINPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPVR
HRPRPYPPNVNEEIQVGHVPRGDVDHHLYPHVLGLNPNASTGQEALSQTTISWTPFQESS
EYIISCHPVGIDEEPLQFRVPGTSASATLTGLTRGATYNIIVEALKDHKRHKVREEVVTV
GNSVDQGLNQPTGDSCFDPYTVSHHAVGEEWERLSESGFKLSCQCLGFGSGHFRCDSSKW
CHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK
EYLGAICSCTCFGGQRGWRCDNCRRPGAEPGHEGSTGHYNQYSQRYHQRTNTNVNCPIEC
FMPLDVQADREDSRE
Download sequence
Identical sequences M3WB06
XP_003991167.1.62641 ENSFCAP00000008544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]