SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008563 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008563
Domain Number 1 Region: 17-310
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.39e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008563   Gene: ENSFCAG00000009238   Transcript: ENSFCAT00000009240
Sequence length 803
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:95961053:96020255:-1 gene:ENSFCAG00000009238 transcript:ENSFCAT00000009240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQREILQKFLDEAQNKKSNKEEFANEFLWLKRQSTKYKADKTYPTTVAERPKNIKKNRY
KDILPYDHSLVELSLITSDEDSNYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEY
SVLIIVMACMEFEMGKKKCERYWTEPGELQLQVGPFSISCEAENRKSDYIIRTLKAKFNS
ETRTLYQFHYRNWPDHDVPSSIDPILELIWDMRSYQEDDHVPVCIHCSAGCGRTGVICAI
DYTWMLLKDGIIPENFSIFSLIQEMRTQRPSFVQTQEQYELVYKAVLELFKRQMDVIRGK
KSGTEIQAKYSVLEQNPTLEAESYSNLPKSGIKEAKMVKQQNKQKIRLKSADASSFGPRT
PEISEKEGLVLHPAEQSSSFDILELNCGCNKNADTTEKWEPKAFPIVGEPLQKHQSLDWS
PVLFNSKPANVAGGYFNSKGPITRAKSTSFELMQQRDTKELDIEENVLCLEPQPHNSPLG
RARKAMHVSSAELNYSLPSDSRRQTGNASNAKQQDASAVQVHSYMSLEDPFFSSLSPSST
GSKMSLDLPERPDGTALPRSPLPASSTTLFSCYNSHDSLALSSPTGHPPPLDQETAVVAT
SPRIDDDIPPPLPERTPESFIVVEEAGEFPQTVPKSLSSAVKVIIGTSLECSGTSESKKS
DDSVRLRPTKSVKLRSPQSDRHQDRSSPPPPPLPERTLESFLLADEDCMQAQSIRTYSTS
CPNTMENSTSSKQTLKTPGKSFTRTKSLKILRNMKKSVSNSSPANKPADSVQSNRSNSFL
NFGFANRFSKPKGPRKPPATWNI
Download sequence
Identical sequences ENSFCAP00000008563 XP_019693202.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]