SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008597 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008597
Domain Number 1 Region: 992-1370
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.89e-79
Family Formin homology 2 domain (FH2 domain) 0.0000927
Further Details:      
 
Domain Number 2 Region: 113-353
Classification Level Classification E-value
Superfamily ARM repeat 5.76e-26
Family Diap1 N-terninal region-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008597   Gene: ENSFCAG00000009272   Transcript: ENSFCAT00000009274
Sequence length 1516
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:45005253:45021252:-1 gene:ENSFCAG00000009272 transcript:ENSFCAT00000009274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSAVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLSAQIPALHRLLAAPLKLEDCA
LQVSPSGYYLDPELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYGSSG
PELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQTYILRALGQLMLFVD
GMLGVVAHSETVQWLYTLCASMSRLVVKTALKLLLVFVEYSENNAPLLIHAVSSVASSTG
CLPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDTFYDVTDALEQQGMEALVQR
HLGTSGTDVDLRTQLVLYENALRLEDGDIDEAAAGGRRERRKPSSEEGKRSRRSLEGGNC
PLRSTEPGPCLLISPASSPTGPVSSRAGPASQTGPTSSPSDLASTVTSTYSTGPALSTSL
NSSLMGPASGLLTSVNLFPAISVGPSADSSSERSIYNCPSTETLHRPSASSAQTPLPKRM
LSLSFQTSPNCSCLVSDCWGVGFSPDWTSYSSCLSPHLFLAFCLSLPFVIYLLAPPFFIS
LSLSLDSLSVPSISSFFMSCHPHPSSFHWGWEGTPDITAQLCVGTSNWALEWSRHHNYHL
FLSSPLPRAPESPPVSQSPTGSAGVSTEASLPGLPFAQGFSIASPSGGSKMKIRTPNLEP
ILPCPQPRNRGWRSNLGLREEGQGLKANKDMGHSSQKLPDMGQPGVPIGTAIPFPCSKGL
ESDSECEQQQGCKECWVGSDPPQMWRNEQGLPWEGKSWVCSAHGLFSVCLCVPAIWGSAQ
GPSKACTPPWAGVCQTPSLTSTSPQSPVPGECGSSRNREAGCTGPGPSRDTGGRDTDSCF
SSLDTRELWGSPEPGPAPRTPQSPAPRSLLRAQRSLEPEPKEPLAPPSPKAEPMQEFPIR
VPKLCIGDLDFSDLGEDEDEDMLNMEAVEAGKGVPPPPPPLPVLSGGGLPPPPPPPPPIK
GSLPPPPPPTTPLPPSAPDGLALPTKRKTVKLFWRELKLAGGHEGSGSRFGPCPTLWASL
EPVSVDTARLEHLFESRAKDVLPSKKAGEGRRTMTTVLDPKRSNAINIGLTTLPPVHVIK
AALLNFDEFAVSKDGIEKLLTMMPTEEERQKIEEAQLANPDIPLGPAENFLMTLASIGGL
AARLQLWAFKLDYDSMEREIAEPLFDLKVGMEQLVQNATFRCILATLLAVGNFLNGSQSS
GFELSYLEKVSEVKDTVRRQSLLHHLCSLVLQTRPDSSDLYSEIPALTRCAKVDFEQLTE
NLGQLERRSRAAEESLRNLAKHELAPALRARLTHFLAQCGRRVAMLRVVHRRVCNRFHAF
LLYLGYTAQAAREVRIMQFCHTLREFALEYRTCRERVLQQQQKRATYRERNKTRGRMITE
TEKFSGVAGEVPSNPSVPVAVGSGPGRGDADSHASMKSLLTSKPEDTTHGRRSRAMGPST
APPEEPPVSNLPSDTSDEIMDLLVQSVTKSSPRALAARERKRSRGNRKSLRRTLKSGLGE
DLVQALGLSKGPGLEV
Download sequence
Identical sequences ENSFCAP00000008597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]