SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008608 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008608
Domain Number 1 Region: 371-514
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 267-372
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-35
Family Second domain of FERM 0.00000403
Further Details:      
 
Domain Number 3 Region: 187-266
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.54e-26
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008608   Gene: ENSFCAG00000009283   Transcript: ENSFCAT00000009286
Sequence length 974
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:120240148:120359237:-1 gene:ENSFCAG00000009283 transcript:ENSFCAT00000009286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSTSEVKKEPEQLGADTDTTKEKTKEVAENQQNQSSDPEEEKGSQSSPTADSQSS
PHRQKREKDPSESRGISRFIPTQAVAEEILDKEESLPEGERQAKGDAEETAQRKQREVKV
DVKEEKPVSGPAAQPADEVSKEREEKAKEIQEDKSEEAKRETKEVQTNELKSEKASQKAT
KKTKTVQCKVTLLDGTEYSCDLEKCAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQKNW
LDPAKEIKRQLRNPPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVT
HALLGSYTLQAELGDYDPEEHGSSDLSDFQFAPTQTKELEEKVAELHKTHRGLSPAQADS
QFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKR
SNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLG
SKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRVSRSLDGAPVGVVDESLMKDFPGPAG
EVSAYGPGAVSTAMVQDGDGRRDLRSPTKVPHVQFVEGKKNSLRVEGDNIYVRHSNLMLE
DLDKAQEDILRHQASISELKRNFMESTPEPRPNEWEKRRITPLSLQTQGSSHETLNVVEE
KQQAEVGKDERVITEEMNGKELSPGSGPGETRKVEPLTQKDSTSLSSESSSGSESEEEED
VGEYRPHHRVTQGTIREEQEEYDEEVEEEAGRAAKVVEREEAVPEASPGRQAGASVSAVE
TVIREKVVAPKLSAEKSVNEGAIKQDMSEETEDEQQHKVNGEVSHVDIDVLPQIICCSEP
PVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGAGGDSGTLLTAQTITS
ESVSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIREAREQHPDMSVTR
VVVHKETELEEGEE
Download sequence
Identical sequences ENSFCAP00000008608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]