SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008663 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008663
Domain Number 1 Region: 998-1096
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-25
Family PDZ domain 0.0000857
Further Details:      
 
Domain Number 2 Region: 850-953
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-25
Family PDZ domain 0.0000944
Further Details:      
 
Domain Number 3 Region: 312-418
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-23
Family PDZ domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 682-782
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-23
Family PDZ domain 0.00037
Further Details:      
 
Domain Number 5 Region: 475-588
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-22
Family PDZ domain 0.00022
Further Details:      
 
Domain Number 6 Region: 150-191
Classification Level Classification E-value
Superfamily WW domain 0.000000000000043
Family WW domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1-49
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000106
Family Nucleotide and nucleoside kinases 0.0035
Further Details:      
 
Domain Number 8 Region: 209-248
Classification Level Classification E-value
Superfamily WW domain 0.000000000542
Family WW domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008663   Gene: ENSFCAG00000009340   Transcript: ENSFCAT00000009342
Sequence length 1277
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:32364816:32490744:-1 gene:ENSFCAG00000009340 transcript:ENSFCAT00000009342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVGTYEGNYYGTPKPPSQPVSGKVITT
DALQSLQSGSKQSTPKRTKSYNDMQNAGIVHTENEEEDDVPEMNSSFTADSGAQEEHTLQ
ETALPPVNSSIVAAPITDASQKFPQYLPLCAEDNLGPLPENWEMAYTENGEVYFIDHNTK
TTSWLDPRCLNKQQKPLEECEDDEEGVHTEELDSELELPAGWEKIEDPVYGIYYVDHINR
KTQYENPVLEAKRKKQLEQQQPQPQPQPQPEGLQGEEDYREWTEHHPCLVPPVTPNHPPS
NPEPAREAPLQGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVL
DGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPFDPD
DPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTGKVNGMKDARPSSPADVASNGSHG
YPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDSPRCRGLKEG
DLIVEVNKKNVQALTHNQVVDMLIECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQN
SSQHSVSSHRSLHTASPSHSTQVLPEYPPAEAPTPDQTDSSGQKKPDPFKIWAQSRSMYE
NRPMSPSPASGLSKGEREREISSTSFGECQIPDYQEQDIFLWRKETGFGFRILGGNEPGE
PIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRR
KVVFTDGIPCSQRLSVKNGFGDGDENFLTSLTQIKYEGRSFENKCFTQNSNTHFVGSIKR
GGGGGSGVVSAAVQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFAGNACVAMPHKIGRI
IEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATL
LTNAEKIATITTTHAPSQQGAQETRNTTKPKPESQFEFKAPQATQEQDFYTVELERGAKG
FGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEILEINGETTKNMKHSRAIELIKN
GGRRVRLFLKRGDGSVPEYDPSSDRLGPAAAGAQGVPEVRAAPPDRRPHPSLESSYPPDL
HKSSPHGEKRAHVRDPKGSREYIRHPTEHHTWNGTSRKPDSGACRPKDRAAEGRREAPPE
RPVPNGPKRRSPEKRREGTRSADTTLERREKHEKRRDVSPERRRERSPTRRRDGSPGHRR
RSLDAGRSSRHAPEQRR
Download sequence
Identical sequences ENSFCAP00000008663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]