SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008752 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008752
Domain Number 1 Region: 883-1160
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-69
Family Protein kinases, catalytic subunit 0.00000765
Further Details:      
 
Domain Number 2 Region: 570-868
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.23e-45
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 3 Region: 459-548,577-603
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000103
Family SH2 domain 0.01
Further Details:      
 
Domain Number 4 Region: 368-433
Classification Level Classification E-value
Superfamily PH domain-like 0.000000443
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 143-267
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000324
Family Second domain of FERM 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008752   Gene: ENSFCAG00000009436   Transcript: ENSFCAT00000009438
Sequence length 1181
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:7638709:7658200:-1 gene:ENSFCAG00000009436 transcript:ENSFCAT00000009438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLCRWGATTRDSRPDGDEAQPMVSRGGLKVLLHWAGPDGGDPWVTFSEATLTAEEVCIH
IAHKVGITPSCLNLFALFDAQAQVWLPPNHILEVSRDTNLTLYFRMRFYFRNWHSMNPQE
PAVYRCGPTRAKSSSEQAEQGVQLLDPASFEYLFEQGKHEFVNDVAPLWELSSEEEIHHF
KNESLGMAFLHLCHLALCHGIPLEKVAKKISFKDCIPRSFRLQLRRHNALTRLRLRRLFR
RFVRAFQPGHVSQPVIMVKYLATLEQLAPRFGTERVLVCRLEEQAQAVGDPCYVQDGGQS
PPEPGPELAPGPPTHEVLVTGTGGIRWRPVQAEGPGGDGCSRNPCAGPSGKKSKAQEVGN
QPVDRPQEAPWAYFCDFQDITHVVLKERHVSIHCQDKCLELTLPSRAVALSLVSLVDGYF
RLTADSSHYLCREVAPPRLVMSIRDGIHGPLLEPFVLAKLRPEDGLYLIHWSTSHLNRLI
LTVAQRDQAPGGQQLHLRKFPIELRAGSFELEGWDRSFPSVRELRTALQGCSLRAGDDCF
SLRRCCLPRPGELSNLIIMRGSRASPGPLNLSQLSFHRVCQDDITQLSHLGQGTRTNVYE
GILRVGERGPKEGTADGGDPPTPSGDRGQELRVVLKVLDPSHHDIALAFYETASLMSQVS
HVHLAFVHGVCVHGSENIMVTEYVEHGPLDVWLRRERGHVPVAWKVAVAQQLASALSYLE
DKSLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWTAPECLSG
GASTLTTAADKWGFGVTLLEICFDGEAPLQGRGPSEKECFYQKQHQLPQPSCPELATLTS
QCLTYEPAQRPSFRTILRDLTQLQPQNLADVLAVNPDSPASDPTVFHKRYLKKIRDLGEG
HFGKVSLYCYDPTNDGTGEMVAVKALKAGGGPQLRTGWRREIDILRTLYHKHIVKYKGCC
EDQGEKSVQLVMEYVPLGSLRDYLPRHNVGLAQLLLFAQQICEGMAYLHAQHYVHRDLAA
RNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVWS
FGVTMYELLTYCDSSQSPPSKFIELIGLTQGQMTVLRLTELLERGERLPRPEKCPCEIYL
LMKNCWEAEASFRPTFQNLIPILKTVQEKYQGQAASVFNVC
Download sequence
Identical sequences M3WBF6
XP_006928454.1.62641 XP_011287340.1.62641 XP_019672993.1.62641 ENSFCAP00000008752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]