SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008766 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008766
Domain Number 1 Region: 478-489,532-903
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 9.55e-106
Family Formin homology 2 domain (FH2 domain) 0.0000141
Further Details:      
 
Domain Number 2 Region: 2-116,179-411
Classification Level Classification E-value
Superfamily ARM repeat 2.18e-94
Family Diap1 N-terninal region-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008766   Gene: ENSFCAG00000009452   Transcript: ENSFCAT00000009454
Sequence length 985
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:79060302:79081866:-1 gene:ENSFCAG00000009452 transcript:ENSFCAT00000009454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHTYIQKLQSFLDPSVTRKKFRRR
VQESTKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQCSVMFDFEGLESGDD
GAFDKLRSWSRSIEDLQPPSALSAPFTNSLARSARQSVLRYSTLPGRRALKNSRLVSQKD
DVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGG
HEIILAAFDNFKEVCKELHRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVEDMNFRVH
LQYEFTKLGLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELE
EHVSHLTEKLLDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKE
EAFQRRCHLEPGARGLESVGSEALARVGPAELSEGMLPSDLDLLAPAPPPEESLPLPPPP
APPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIRIKKPIKTKFRLPVFNWTALKPN
QISGTVFSELDDEKILEDLDLDKFEELFKTKAQGPALDLICSKNKTAQKAASKVTLLEAN
RAKNLAITLRKAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYERERQ
PLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQK
LKQMLEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPD
LANFWHELHFVEKAAAVSLENVLLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLD
KLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVM
REKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAKEHRPVYEGKDGTIEDIITGLHR
QPIVVRHQARSAAPPNGPPRAPGPH
Download sequence
Identical sequences ENSFCAP00000008766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]