SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008808 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008808
Domain Number 1 Region: 340-530
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 6.8e-80
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.000000121
Further Details:      
 
Domain Number 2 Region: 13-105
Classification Level Classification E-value
Superfamily A heparin-binding domain 1.02e-41
Family A heparin-binding domain 0.00000577
Further Details:      
 
Domain Number 3 Region: 106-171
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 3.92e-28
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000594
Further Details:      
 
Domain Number 4 Region: 271-330
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008808   Gene: ENSFCAG00000009497   Transcript: ENSFCAT00000009499
Sequence length 729
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:26644261:26680924:1 gene:ENSFCAG00000009497 transcript:ENSFCAT00000009499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFGTKEEVLQYCQEM
YPELQITNVMEANEPVSVDNWCRRDKKQCKSHIVIPFKCLVGEFVSDVLLVPEKCQFFHK
ERMEVCENHQHWHTVVKEACLTEGMTLYRYGMLLPCGVDQFHGTEYVCCPQTKTIESTVS
KEEEEDEEEEEEEDEEEDYDIYKSEFPTEADLEDFTEAAVDEDDGDEEEGEEVVEDRDYY
YDTFKGDDYNEENPTEPSSDGTVSEKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGK
CVRFIYGGCGGNRNNFESEDYCMAVCKAMIPPTPLPTNDVDVYFETSADDNEHARFQKAK
EQLEIRHRNRMDRVKKEWEEAELQAKNLPKAERQTLIQHFQAMVKALEKEAASEKQQLVE
THLARVEAMLNDRRRMALENYLAALQSDPPRPHRVLQALRRYVRAENKDRLHTIRHYQHV
LAVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQ
FTASISETPVDVRVSSEESDEIPPFHPFHPFPSLPENEDTQPELYHPMKKGSGVGEQEGG
LIGAEEKVINSKNKVDENMVIDETLDVKEMIFNAERVGGLETEPESVGPLREDFSLSSSA
LIGLLVIAVAIATVIVISLVMLRKRQYGTISHGIVEVDPMLTPEERHLNKMQNHGYENPT
YKYLEQMQI
Download sequence
Identical sequences ENSFCAP00000008808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]