SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008931 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008931
Domain Number 1 Region: 976-1251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-70
Family Tandem AAA-ATPase domain 0.0000311
Further Details:      
 
Domain Number 2 Region: 742-974
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.53e-53
Family Tandem AAA-ATPase domain 0.0000713
Further Details:      
 
Domain Number 3 Region: 478-525,552-598
Classification Level Classification E-value
Superfamily Chromo domain-like 6.23e-17
Family Chromo domain 0.019
Further Details:      
 
Domain Number 4 Region: 375-432
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.08e-16
Family PHD domain 0.0016
Further Details:      
 
Domain Number 5 Region: 618-691
Classification Level Classification E-value
Superfamily Chromo domain-like 3.34e-16
Family Chromo domain 0.0055
Further Details:      
 
Domain Number 6 Region: 166-205
Classification Level Classification E-value
Superfamily HMG-box 0.0000796
Family HMG-box 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000008931
Domain Number - Region: 25-36
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000141
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008931   Gene: ENSFCAG00000009629   Transcript: ENSFCAT00000009631
Sequence length 2003
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:2071965:2654649:1 gene:ENSFCAG00000009629 transcript:ENSFCAT00000009631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRGPGPRGRDRHSPPGPLLSPPPPPPPPPTPPPPPPSPKDKDDLRLLPSALGVKKRKRG
PKKQKENKPGKPRKRKKLDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEK
KTKRRKKGEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLI
AKKNPKIPMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSTAP
VAPSGPPTLPAPPSADTQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPLK
IKLGLLGGKRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPG
RKKKKVLGCPAVAGEDEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRA
PEGKWSCPHCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDA
CISSYHIHCLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVSVPAPQQADGN
PDAPPPRPLQGRSEREFFVKWVGLSYWHCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPL
DYGSGEDDGKSDKRKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINHSVDKKGSYHYLVKW
RDLPYDQSTWEEDEMSIPEYEEHKQSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPSS
PTNDPTVKYETQPRFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIV
FLYSLYKEGHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSF
EDNAIKGGKKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQS
KFFRVLNGYKIDHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQI
KKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKYILTRNFEALNSRGGG
NQVSLLNIMMDLKKCCNHPYLFPVAAMESPKLPSGAYEGGALIKASGKLMLLQKMLRKLK
EQGHRVLIFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFL
LSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEER
ITQVAKRKMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVI
HYDNEAIARLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENV
DPDYWEKLLRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDED
FDERPEGRRQSKRQLRNEKDKPLPPLLARVGGNIEVLGFNTRQRKAFLNAVMRWGMPPQD
AFTTQWLVRDLRGKTEKEFKAYVSLFMRHLCEPGADGSETFADGVPREGLSRQQVLTRIG
VMSLVKKKVQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPTTPEASATNSPCTS
KPATPAPSEKGDGVRTPLEKDEAENQEEKPERKIEKMETEADAPSPAPSLGERLEPRKIP
LEEEVSGIAGEMEPEPGYRGDREKSATESTPGERGEEKPLDGQEHRERPEGETGDLGKRE
DVKGDRELRPGPPRDEPRSNGRREEKAEKPRFMFNIADGGFTELHTLWQNEERAAVSSGR
LNEIWHRRHDYWLLAGIVLHGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLAR
RFKLLEQALVIEEQLRRAAYLNLSQEPAHPAMALHARFAEAECLAESHQHLSKESGNKPA
NAVLHKVLNQLEELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPT
PAFPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMV
GALVSDGLDRKEPRAGEVICIDD
Download sequence
Identical sequences ENSFCAP00000008931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]