SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008976 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008976
Domain Number 1 Region: 114-396
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-112
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000212
Further Details:      
 
Domain Number 2 Region: 399-691
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.75e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008976   Gene: ENSFCAG00000009676   Transcript: ENSFCAT00000009682
Sequence length 701
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:85212750:85258593:1 gene:ENSFCAG00000009676 transcript:ENSFCAT00000009682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPFCLLLLAGVSLPFAKALKGNETTPAESNLTSTTAGPPDPRASQPLLAWLLLPLLLLV
VSLLLAAYFFRFRKQRKAVVSANDKKVPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVAH
LEEEIRVRSADDCKRFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILS
QVDGAPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMIWEQKSATIVMLTNLKER
KEEKCYQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQSQLPDGCKAPRLVSQLHFT
SWPDFGVPFTPIGMLKFLKKVKALNPAHAGPIVVHCSAGVGRTGTFIVIDAMMDMMHAEH
KVDVFDFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLENHLQTLHGTAT
HFDKIGLEEEFRKLTNVRIMKEDMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEYT
DYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMVWEWKCHTVVMLTEVQEREQDKCYQY
WPTEGSVTHGEITIEIKSDTLSEAISIRDFLVTFNQPLARQEEQTRLVRQFHFHGWPEIG
IPAEGKGMLDLIAAVQKQQQQTGNHPITVHCSAGAGRTGTFIALSNILERVKAEGLLDVF
QAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK
Download sequence
Identical sequences M3WBW1
ENSFCAP00000008976 XP_019669549.1.62641 XP_019669550.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]