SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008988 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008988
Domain Number 1 Region: 220-522
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000031
Further Details:      
 
Domain Number 2 Region: 111-216
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-31
Family SH2 domain 0.000000695
Further Details:      
 
Domain Number 3 Region: 5-106
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-29
Family SH2 domain 0.00000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008988   Gene: ENSFCAG00000009695   Transcript: ENSFCAT00000009696
Sequence length 593
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:10106703:10161759:1 gene:ENSFCAG00000009695 transcript:ENSFCAT00000009696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSCSRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDECALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHF
RTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIR
EKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGH
EYTNIKYSLTDQTSGDQSPLPPCTPTPSCAEMREDNARVYENVGLMQQQKSFR
Download sequence
Identical sequences ENSFCAP00000008988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]