SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009108 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009108
Domain Number 1 Region: 75-122
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000628
Family Elafin-like 0.00043
Further Details:      
 
Domain Number 2 Region: 29-73
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000017
Family Elafin-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009108   Gene: ENSFCAG00000009819   Transcript: ENSFCAT00000009821
Sequence length 124
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:15270348:15274087:-1 gene:ENSFCAG00000009819 transcript:ENSFCAT00000009821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPACRPGLHAVPLLLGLLLLGLSPVPGREAEKTGVCPQLQADLNCTQECQSDAQCADNLK
CCQAGCATICHLPDEKQGSCPHVNTDFPQLGLCQDQCKVDSQCPGLLKCCYNGCGKVSCI
TPIF
Download sequence
Identical sequences M3WC68
ENSFCAP00000009108 XP_003983477.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]