SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009110 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009110
Domain Number 1 Region: 63-127
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0018
Further Details:      
 
Domain Number 2 Region: 29-69
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000706
Family Elafin-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009110   Gene: ENSFCAG00000009821   Transcript: ENSFCAT00000009823
Sequence length 130
Comment pep:novel chromosome:Felis_catus_6.2:A3:15236255:15242775:1 gene:ENSFCAG00000009821 transcript:ENSFCAT00000009823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSRLLSILVLSAFLVNVQGFGDWIFPRRCPRIQEKCEFKERDECTKDRQCLDNKKCCI
FSCGKKCLDLHQDICDMPKETGPCMAFFHRWWYDKEKGTCSRFIYGGCKGNNNNFQTKDM
CQNMCSKKRL
Download sequence
Identical sequences XP_006929779.1.62641 XP_014920910.1.86478 ENSFCAP00000009110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]