SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009198 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009198
Domain Number 1 Region: 365-567
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.3e-48
Family Nucleotide and nucleoside kinases 0.00013
Further Details:      
 
Domain Number 2 Region: 184-320
Classification Level Classification E-value
Superfamily SH3-domain 1.6e-23
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 136-220
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-20
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 4 Region: 70-121
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000006
Family L27 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009198   Gene: ENSFCAG00000009913   Transcript: ENSFCAT00000009916
Sequence length 572
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:43925737:43950522:-1 gene:ENSFCAG00000009913 transcript:ENSFCAT00000009916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLSEDSVSSGLHETLALLTSQLRPDSNHKEEMGFLRDVFSEKSLSYLMKIHEKLRYYE
RQSPTPVLHSAVALAEDVIEELQAASVHSDERELLQLLSTPHLKAMLMVHDTVAQKNFDP
VLPPLPENIDEDFDEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLV
HVGDELREVNGITVLHKRPDEISQILAQSQGSITLKIIPATQEEGRLKDSKVFMRALFHY
NPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSKQFQERRLS
YRRATGTLPSPQSLRKPPSGLRRSFRLGRRERLGSPQEGKVSAVAESPELLTYEEVTRYQ
HQPGERPRLVVLIGSLGARLHELKQKVVAENPQHFGVAIPHTTRPRKSHEKEGVEYHFVS
KQAFEADLHHNKFLEHGEYKENLYGTSLDAIQAVMARNKVCLVDVEPDALQQLRTSEFKP
YVIFVKPAIQEKRKTPPTSPACEDTAAPLXITEDEQQREMAASAAFIDQHYGHLVDSVLV
KQDLQSAHSQLRALLEKLTKDTHWVPVSWVRT
Download sequence
Identical sequences ENSFCAP00000009198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]