SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009306 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009306
Domain Number 1 Region: 2219-2456
Classification Level Classification E-value
Superfamily Plakin repeat 4.27e-84
Family Plakin repeat 0.000000000583
Further Details:      
 
Domain Number 2 Region: 1977-2212
Classification Level Classification E-value
Superfamily Plakin repeat 1.13e-76
Family Plakin repeat 0.00000235
Further Details:      
 
Domain Number 3 Region: 2530-2570,2619-2813
Classification Level Classification E-value
Superfamily Plakin repeat 1.66e-68
Family Plakin repeat 0.00000000849
Further Details:      
 
Domain Number 4 Region: 845-973,1000-1027
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000205
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 5 Region: 335-464
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000209
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 6 Region: 2469-2523
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000471
Family Plakin repeat 0.0052
Further Details:      
 
Domain Number 7 Region: 198-281
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000117
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009306   Gene: ENSFCAG00000010022   Transcript: ENSFCAT00000010027
Sequence length 2884
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:20904319:20953743:-1 gene:ENSFCAG00000010022 transcript:ENSFCAT00000010027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCNGGSHPRINTLGRMTRAESGPDLRYEVTCGGGGGGGGGGGGGTSRMYYSRRCTVTDQ
NSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLARSRELDECF
AQANDQMEITDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGG
YTCQSGSGWDEFTKRLTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRSIHNAIGDY
RWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEE
EELLYDWSDRNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYM
DTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPL
QRLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQ
DQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYE
AILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTISDLELHYQEFI
RNSQGSEMFGDDDKRKMQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGSCQDVNH
NKVIETNREHDKQETWMLMELQKIRRQMEHCEGRMSLKNILLADQGSTHHITVKINELKS
VQNDSQAIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVR
ALLQAILQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTE
LQKAQQIHSQTSQQYPLYDLDLGKFSDKVTQLTDRWQKIDKQIDYRLWDLEKQIKQLRNY
RDNYQAFCKWLYDAKRRQDSLESMKFGDSNTVLRFLNEQKNLHNEICGKRDKSDEVQKIA
ELCANSIKDYELQLASYTSGLETLLNIPIKRTMVQSPSGVILQEAADMHARYIELLTRSG
DYYRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQ
FKAKLVSLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKAVEDR
FDQQKNDYDQLQKARQCEKESLGWQKMESEKAIKEKEYEIERLRVLLQEEGARKREYESE
LAKVRNHYNEEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKD
EIVRLNDSILQTTEQRRRAEEDALQQKACGSEMMQKKQHLEMELKQVIQQRSEDNARHKQ
SLEEAAKTIQDKNKEIERLKVEFQEEAKRRWEYENELAKVRNNYDEEIISLKNQFETEIN
ITKTTIHQLTMQKEEDTSGYRAQIDSLTRENRSLSEEVKRLKNTLAQTTENLRRVEEDVQ
QQKATGSEVSQRKQQLEIELRQVTQMRTEESLRYKQSLDDAAKTIQDKNKEIERLKQLIE
TETSERKRLEEENAKLQRAQYDLQKANNSATETISKLKVQEQELTRLRIDYERVSQERAV
KDQDITRFQSSLKDLQLQKQKVEEELNRLRRTASEDSLKRKKLEEELEGMRRSLKEQAIK
ITSLTQQLEQASIVKKRSEDDLRQQRDVLDGHLRDKQRTQEELRRLSAEVEALRRQLLQE
QENVKQAHLRNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEY
DDLRRSRSEADSNRNATISELRSQLQISNNRTLELQGLINDLQRERENLRQEIDKFQKQA
LEASNRIQESKNQCTQVVQERESLLVKIKVLEQDKSRLQRLEDELTRAKATLDAESRVKQ
RLECEKQQIQNDLNQWKTQYSRKEETIRKIESEREKSEREKNSLRSEIERLQAEIKRIEE
RYRRKLEDSTRETQSQLETERSRLQREIDKLKQRPYGSHRETQTEYEWTVDSSKLVFDGL
RKKVTAMQLYECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGAIAGASASPKEKYSL
VEAKRKKLITPESTVMLLEAQAATGGIIDPHRNEKLTVDNAIARDLIDFDDRQQIYTAEK
AITGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALAR
GLIDRDLYRSLNDPRDSQKNFVDPVTKKKVSYMQLRERCRIEPHTGLLLLSVQKRSMSFQ
GIRQQVTVSELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQK
LGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLS
AERAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDMA
YKRGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKK
EVQTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFRELCEQECEWEEITITGS
DGSTRVVLVDRKTGSQYDIQEAVDKGLIDRKFFDQYRSGSLSLTQFADMISLKNGVGNSS
GIGGGISDDVFSNSRHESVSKISTISSVRNITIRSSSLSDPLEESSPIAAIFDTENLEKI
SITEGIERGIVDSITGQRLLEAQACTGGIIHPTSGQKLSLQDAVSQGLIDQDMATRLKPA
QKAFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAI
RKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAMNRSMVEDITGLRLLEAASVSSK
GLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSS
SIGH
Download sequence
Identical sequences M3WCK3
ENSFCAP00000009306 XP_003985873.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]