SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009431 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000009431
Domain Number - Region: 404-442
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.08
Family Nuclear receptor ligand-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009431   Gene: ENSFCAG00000010157   Transcript: ENSFCAT00000010160
Sequence length 1132
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:83212103:83250831:1 gene:ENSFCAG00000010157 transcript:ENSFCAT00000010160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINK
KFPNIDVRSSTQHLGPVHREKSEIIRFLINYYQSFVDVMEFRDHVYELLNTIDACQCHFD
INLNFDFTRSYLDLIVTYTSVILLLSRIEDRRVLIGMYNCAHEMLHGHSDPSFARLGQMV
LEYDHPLKKLTEEFGPHTKAVSEALLSLHFLFVRRTQGAEQWRSAQLLSLISSPPAMINP
ANSDTMACEYLSVEVMERWIIIGFLLCNGCLNSNNQCQKLWKLCLQGSLYITLIREDVLQ
VHKVTEDLFSSWKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLTDEPG
LLGPKALYAFMALSFIRDEVTWLVRHTENVTKTKTPEDYVDSSIAELLFLLEEIRALVRR
HIKVIQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSTLSNLNLKQVDSGEKF
EFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVETILVETSDLST
FCFHLRTFEKMFAVTLEEPTMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNS
FLEELAKQTSNCVLELCAEQRNLSEQLLPKHCATTISKAKNKKIMKQRQTPRKGEPERDK
PGAESHRKNRSVVTNMDKLHLNLTELALTMNHVHSFSVFEHTIFPSEYLSSHLEARLNRA
IVWLAGYNATTQEIARPSELLAGVKAYVGFIQSLAQFVGADVSRVIRNALLQQTQPLDSC
GEQTITTLYTNWYLESLLRQASGGTIILSPAMQAFISLPREGEQNFSAEEFSDISEMRAL
AELLGPYGMKFLSENLMWHVTSQIMELKKLVVENMDVLVQIRSNFSKADLMASLLPQLIG
ADNVLKRMTIIGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIF
ELASAAGVGCDIDPALVAAIANLKADTSSPEEEYKVACLLLIFLAVSLPLLAADPSSFYS
IEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETILPLQVASVSLLQLGQETDKLKTRNR
ESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSRTFHLNRVPTSTH
Download sequence
Identical sequences ENSFCAP00000009431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]