SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009659 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009659
Domain Number 1 Region: 130-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-79
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 77-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.46e-27
Family Nuclear receptor 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009659   Gene: ENSFCAG00000010409   Transcript: ENSFCAT00000010411
Sequence length 448
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:140861359:141031874:1 gene:ENSFCAG00000010409 transcript:ENSFCAT00000010411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNPAEHSPSISPSSVENSGVSQSPLVQ
Download sequence
Identical sequences E2R2A6 M3WD77
9615.ENSCAFP00000008570 ENSCAFP00000008570 XP_003992222.1.62641 XP_019278466.1.44245 XP_850755.1.84170 ENSFCAP00000009659 ENSCAFP00000008570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]