SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009773 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009773
Domain Number 1 Region: 110-222
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.05e-33
Family Canonical RBD 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009773   Gene: ENSFCAG00000010526   Transcript: ENSFCAT00000010529
Sequence length 290
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:84017297:84024583:1 gene:ENSFCAG00000010526 transcript:ENSFCAT00000010529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSFDWEYYGYTESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRSR
RSSRRHYTRSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCLG
VFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANG
MELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSYS
LHRGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRKY
Download sequence
Identical sequences ENSFCAP00000009773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]