SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009781 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009781
Domain Number 1 Region: 46-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-17
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 2 Region: 255-318
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000017
Family Centromere-binding 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000009781
Domain Number - Region: 196-238
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0116
Family Cgl2762-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009781   Gene: ENSFCAG00000010534   Transcript: ENSFCAT00000010537
Sequence length 609
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:9449255:9463667:1 gene:ENSFCAG00000010534 transcript:ENSFCAT00000010537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTAYTLNLTLKEEEEEEEIQSRELEDGPTDMQKVRICSEGGWVPALFDEVAIYFSDEE
WEVLTEQQKALYREVMRMNYETVLSLEFPFPKPDMITRLEGDEESQNSDEWQLQGGTLAE
NEETDVKPPDWAGPMNATPHFPQPQHLDGFGLRLPRDLTELPEWSEGYPFYMAMGFPGYD
LSADDIAGKFQFSRGMRRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQ
LQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPE
KGFKASLGWCRRMMRRYDLSLRHKVPVPQQLPEDLTEKLVTYQRSVLALRRAHDYQVAQM
GNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGT
YIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWRRRTGAAPKQRGMLILNGFRGHATDS
VKSSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAK
KPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEDEDDVLWEIESELPGGGEGPREC
DTESAPEGN
Download sequence
Identical sequences A0A2I2U2A0
ENSFCAP00000009781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]