SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009794 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009794
Domain Number 1 Region: 325-509
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.7e-26
Family Ankyrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009794   Gene: ENSFCAG00000010549   Transcript: ENSFCAT00000010552
Sequence length 968
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:101301987:101392644:1 gene:ENSFCAG00000010549 transcript:ENSFCAT00000010552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPEYLDLDEIDFSDDISYSVTSLKTIPELCRRCDAQSEDRSVSSSSWNCSVSALITNT
QKPTGIADVYSKFRPVKRVSPLKHQPETLDNNESDDQKNQKVECQKGSDSEPGPPPEELS
PGDGDSGPQSKSTEPSTLLGELEHYDLDMDEILDVPYIKSSQQLAPFTKVTSDKRILGLC
TTINGLSGKACSPGSAESSPSTLTPFCVLSPVKSPHLRKASSIIRDQQKLSAEESESSPP
LVKCGSAYEPENQSKDFLNKTFSDPHSRKREKAMPDCQLRDFHPQSSATEPKVEEQIGGV
SWTSSQGPEERSEYLKKGKSILNIVKEGQISLLPHLAADNLDKIHDETGNNLLHVAASQG
HAECLQHLTSLMGEDCLSERNAERLTPAGLAIKNGQLECVRWMVSETEAIAELSCSKDFP
SLIHYAGCFGQEKILLWLLQFMQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYGA
NVTMHNHAGEKPSQSAERHGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTMERVTLQN
QLQQLLEAQKSEDKSLLSSPSSPSSPASRRSQWKSPDADDESVAKSKPGVQEGIQVLGSL
SASSRARAKAKDEDSDKILRQLLGKDISESVCTQEKLSLEFQDAQASSRNSKKIPADKRE
LKLARLRQLMQRSLSESDTDSNTSEDPKSTPVRKADRPRPQPIVGSVESVDSAESLHLMI
KKHTLASGRRFPFGIKASKSLDGHSPSPTSESSEPDLESQCPASGTTPPSQPSGDPTQPS
PDSTATQKVAMSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQASLEPTGEKDRDKGR
TPQRTSTGSESGDQLKRPFGTFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRKTT
DAKRSPVSSASKGKNKAEMYGSCVTLSSNTLTEEPLRNRARHNDINRKMKKSYSIKHIAE
PESNELFL
Download sequence
Identical sequences A0A2I2V1R4
XP_011280103.1.62641 XP_019686989.1.62641 XP_019686990.1.62641 ENSFCAP00000009794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]