SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009815 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009815
Domain Number 1 Region: 13-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-43
Family Dual specificity phosphatase-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009815   Gene: ENSFCAG00000010571   Transcript: ENSFCAT00000010574
Sequence length 198
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:23262658:23263251:-1 gene:ENSFCAG00000010571 transcript:ENSFCAT00000010574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNAT
IEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSAT
LCIAYLMKFHSVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGI
VPDVYEKESRHLMPYWGI
Download sequence
Identical sequences K9IGG1
XP_006940162.1.62641 XP_007096094.1.5354 XP_014933937.1.86478 XP_019279559.1.44245 ENSFCAP00000009815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]