SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009851 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009851
Domain Number 1 Region: 77-135
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-19
Family Fibronectin type II module 0.0054
Further Details:      
 
Domain Number 2 Region: 196-241
Classification Level Classification E-value
Superfamily Kringle-like 7.14e-16
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 3 Region: 46-89
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000942
Family Fibronectin type II module 0.0022
Further Details:      
 
Domain Number 4 Region: 137-188
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000143
Family Fibronectin type II module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009851   Gene: ENSFCAG00000010611   Transcript: ENSFCAT00000010614
Sequence length 241
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:10822890:10836874:1 gene:ENSFCAG00000010611 transcript:ENSFCAT00000010614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRWSGYLLGWMTFLYIWETSGEIPKLRSLEFMKPWLCISKGQKDSCVFPFVYKGSTYFS
CIKTNSLSPWCSTKAVYDGQWKYCMEEDYPRCIFPFIYRGRYHNNCITEGGFFRKLWCSV
TSSFDEKQQWKYCETNEYGGNSFSKPCVFPSVYRNSMIFECIESESNRLWCPTTENMDED
GKWSLCADTRISSLVPGFPCHFPFNYKNKNYFNCTSKGSKHNLTWCATSYNYDQDHTWVY
C
Download sequence
Identical sequences ENSFCAP00000009851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]