SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009986 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009986
Domain Number 1 Region: 46-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.3e-39
Family SCAN domain 0.0000663
Further Details:      
 
Domain Number 2 Region: 225-270
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000112
Family KRAB domain (Kruppel-associated box) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009986   Gene: ENSFCAG00000010750   Transcript: ENSFCAT00000010753
Sequence length 270
Comment pep:novel chromosome:Felis_catus_6.2:C2:157490748:157502335:1 gene:ENSFCAG00000010750 transcript:ENSFCAT00000010753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQGRGTLGLIPRGAVLQKQEWRQTMKQEPGSQTWGQACNLQKNHPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCHWWLMPEVHTKEQILELLVLEQFLTILPGELRTWVQLHQPE
NGEEAVAVVEDFQRHLSGPGEVSTPAQEQEIHLEETTALGTSEEFLPTSPLSEGSAPEAH
LEPPQDPGTYLLHNGHSGQCASQVPAVSQAGKSGDQAAATVLRMVRPQGSAAYEFLSVDY
TERKWKGPALSQRAVYRSLMPENYRRVASL
Download sequence
Identical sequences ENSFCAP00000009986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]