SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010157 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010157
Domain Number 1 Region: 774-880
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000432
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 2 Region: 1079-1188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000589
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 3 Region: 960-1055
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000864
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010157   Gene: ENSFCAG00000010934   Transcript: ENSFCAT00000010937
Sequence length 2189
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:83641359:84003023:1 gene:ENSFCAG00000010934 transcript:ENSFCAT00000010937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTMSVTLSPLRSQDLDPMATDASPMAINLTPTVEQGEGEEAMKDMDSDQQYEKPPPLHT
GADWKIVLHLPEIETWLRMTSERVRDLTYSVQQDSDSKHVDVHLVQLKDICEDISDHVEQ
IHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQT
DILQAFSEETNEGRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLGGL
GDMTSSQVKTKPFDSWSYSEMEKEFPELIRSVGLLTVATDPVPPNCSEAVREERSQVSLS
ADDRGGCEKNSASTVEEPPGLMPGMSSSGEALTNAEQPPSEAVKQESSSSSQLGAKNQQP
LPCENATPKRSIRDCFNYNEDSPTQPTLPKRGLFLKEETFKNNLKGTVTNKQMADLKPEL
SRSTPSLVEAPDRSKLCLVLQSSYPNSPSAASQSYECLHKVADGNLENTVKSHIKEISSS
LGRLSDCHKEKPRLKKPHKAPAEVPLCRTPKRGAGSGKQAENTRSSVVSNGIPSGTSNAT
ERPETDSVSTSSLEPCNQRSWDAKLPVRSETSSSPPLTQSSESSAGSDSILSPVPLLSKH
KSKKSYSSSPSHVTRNGQVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQKPRGE
TIQNIDDWELSEMNSDSEIYPTYHVKKKHTRLGRVSPSSSSDIASSLGESMESGPLSDIL
SDEELCMPLSGMKKYIDEKSERASSSEKNESHSATKSALIQKLMQDIQHQDNYEAIWEKI
EGFVNKLDEFIQWLNEAMETTENWTPPKAETDGLKLYLETHLSFKLNVDSHCALKEAVEE
EGHQLLELIASHKAGLKDMLRMIASQWKELQRQIKRQHSWILRALDTIKAEILATDVSVE
DEEGTGSPKAEVQLCYLEAQRDAVEQMSLKLYSEQYTSSSKRKEEFADMSKVHSVGGNGL
LDFDSEYQELWDWLIDMESLVMDSHDLMMSEEQQRHLYKRYSVEMSIRDLKKTELLSKVE
ALKKGGVLLPNDLLEKVDSINEKWELLGKTLGQKIQDTMAGHSGSGPRDLLSPESGSLVR
QLEVRIKELKGWLRDTELFIFNSCLRQEKEGTMNAEKQLQYFKSLCGEIKQRRRGVASIL
RLCQHLLDDRDTCNLNADHQPMQLIIVNLERRWEAIVMQAVQWQTRLQKKMGKESETLNV
IDPGLMDLNGTSEDALEWDETDISNKLISLNEESNDLDQEPQPLMPSLKLEEIGGEDPGY
EEEAGDHGGSQYASSVTVPSSPHIYQVYSLHNVELCEDSSMPFLKNNPKFTSMTQPSVLT
KSLSKDSSFSSTKSLPDLLGGSSLVKPCPCHGGDMSQNSGSESGIVSEGDTETTTNSEMC
LLNMVDGSPSNLETEHLDPQMGDAVNVLKQKFKDEEERIKLPNSSQPSISPVGCVNGKVG
DLNSVTKYTPDCLGEELQGKHDVFTFYDYSYLQGSKLKLPMIMKQSQSEKAHVEDPLLRF
YFDKKSCKSKHQATELQPDAPPHEKILASASHEMDRNSYKSGDVEKTFTGMQNARQLSLL
SHSSSIESLSPGGDLFGLGILKNGSDSLQRSTSLESWLTSYKSNEDLFSCHSSGDISVSS
GSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSSSQKMPFTGQLSLDIASSINE
DSPASLTELSSSDELSLCSEDIVLHKNKVPESNASFRKRLTRSVADESDVNVSMIVNVSC
TSACTDDEDDSDLLSSSTLTLTEEELCIKDEDDDSSIATDDEIYEECNLMSGLDYIKNEL
QTWIRPKISLTKDKRRCNISDEIKGSKDVSSSEMTNPSDTLNIEALLNSSIKCLSENNGN
GKNLSNTHEIGTKGENKKNVFKVNKDPYVADMENGNIEGTPERQKDKQNGISKESDNLGS
TGKKNSDSEHCKCKVFMDSSDDSNIAGKESVPQTVRHRPKKCQNHHHVENPTTASIPTEK
SCPELPSETSIINRQDSEVLKPSPNDAPNMAGKSAPCCLALEQNETEENVSVSDNISCCD
CEPDVFHQKDAEDCSVHDFVKEIIDMASTALKSKSQPENEAAAPTSLTQIKEKVLEHSHR
PIQLRKGDFYSYLSLSSHDSDCGEVTNYVEEKSNTPLPLDISDSGLEDKEDTECFFEACV
EDDPDGVEPCLPHAPPNEPVSVEAALPQQ
Download sequence
Identical sequences ENSFCAP00000010157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]