SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010170 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010170
Domain Number 1 Region: 168-300
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-38
Family Third domain of FERM 0.00053
Further Details:      
 
Domain Number 2 Region: 66-170
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-20
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010170   Gene: ENSFCAG00000010945   Transcript: ENSFCAT00000010950
Sequence length 799
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:71999239:72129860:-1 gene:ENSFCAG00000010945 transcript:ENSFCAT00000010950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHAKGQDLFDQIVYHLDLVETDYFGLQFLDSSQVAHWLDHSKPIKKQMKIGPAYALHFRV
KYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHT
PELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGR
DGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFV
FRLDSARTCKHLWKCAVEHHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGAR
LRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQFCSKTNPEVHNYQPQYHPNIHPSQPRW
HPHSPNVSYPLPSPGLSSADRLPFGIEENGGTPFTTKASGRHHHHHHQHQHHPNYGLSLT
LENKEGPLRSPNSSSKSLTKLSPGGPALFSEAAAHLKKLELETVKAAGPWPALHININKA
EEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVSAQQVGKEESTFVNINKKSSLQ
DAKVRSPIPIRVETTQPAVEKPEIKPPRVRKLTRQYSFNRSDEDDLPPDLAEAVGASTAA
TTHTTTATTQVSAPLVSPKGHKVSSPQNSEGKGPLSPGAKSPSDRGGAFTLEPGDLLMDF
TEATPLAEPASAPHCAHSRCSPPLSPPMKEETTGVCMHPPIKTRLIKTFPADPVTPFPDA
FITGPQFAADFRDSKLQCCPGQSSPLIPSVTLRPLTETVSTVQTIYTTRKPVSLAASAET
LRQELEREKMMKRLLMTEL
Download sequence
Identical sequences ENSFCAP00000010170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]