SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010171 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010171
Domain Number 1 Region: 629-903
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.44e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000773
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-35
Family Third domain of FERM 0.00016
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.14e-32
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 4 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-20
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-19
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010171   Gene: ENSFCAG00000010948   Transcript: ENSFCAT00000010951
Sequence length 913
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:72172439:72249845:-1 gene:ENSFCAG00000010948 transcript:ENSFCAT00000010951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINNIRASELPKEKTRSEVVCSIRFLDGLVQTFKANKQDTGQVLLDMAYN
HLGVTEKEYFGLQHGDDSVDSLRWLESSKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYDSSIHHPGYLSDSQFIPDQ
NDDFLTKVESLHEQHSGLKQSEAESCFINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNPKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKASL
SPKDSDSEVSQNRSPHRESLSENNPAQSCLTQKSSSSVSPSSNAPGSCSTDGVDQQFIEA
FHRVTKGGSTEDSSQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELALVIRRKAVH
SFTDIRSEDELNQLFPEAIFPTCPEGGDTLEGSMEQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIAAQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMEHGNFHIRCQSEDCT
IAYVFREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDGEPVLV
HCSAGIGRTGVLVTMETAMCLTERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLDPS
Download sequence
Identical sequences M3WE86
ENSFCAP00000010171 XP_003995787.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]