SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010231 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010231
Domain Number 1 Region: 233-282
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000544
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010231
Domain Number - Region: 345-402
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0213
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010231   Gene: ENSFCAG00000011015   Transcript: ENSFCAT00000011018
Sequence length 815
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:16624664:16658841:1 gene:ENSFCAG00000011015 transcript:ENSFCAT00000011018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPDPDVDRKLHFPEXAATASDMDKNSGSSSSSASSGSSKGQQPPSASAGPAGESKPKSV
SDGKNSSGSKRFNRKREPSYPKNENFSNQSRRSNSQKSKTFNKMPPQRGGGSSKVFSSSF
NGGRRDEVAEAQRAEFSPAQFSGPKKINLNHLLNFTFEPRGQAGHFEGSGHGSWGKRNKW
GHKPFNKELFLQANCQFVVSEDQDYTVHFADPDTLVNWDFVEQVRICSHEVPSCPICLYP
PTAAKITRCGHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKSVVATESRQYVVGDT
ITMQLMKREKGVLLALPKSKWMNVDHPIHLGDEQHSQYSKLLLASKEQVLHRVVQEEKIA
LEQQLAEEKHTPESCFIEAAIQELKTREEALSGLAESRGEVLSVVPALEQLVLMAPLAKE
SVFQPRKGVLDYLSAFDEETTEVCSLGSPRPLALPLVEEEEAVSEPEPEACDDSELADDS
LGEGTICTESSQQEPITKPGFTHLSGSPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLEQ
SPEKISAVVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVVSKETLEIFSDD
IEKRKRQRQKKAREERRRERRIEMEENKKQGKYPEVHIPLENLQQFPAFNSYTCTSDSAL
GPTSTEGHGALSLSPLSRSPGSQADFLLTPLSPTASQGSPSFCVGSLEEDSPFPSFAQML
RVGKAKADVWPKTAPKKDENSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIEAAFMKL
DTPATSDPLSEEKGGKKRKKQKQKLLFSTSVVHTK
Download sequence
Identical sequences ENSFCAP00000010231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]