SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010361 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010361
Domain Number 1 Region: 7-292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-80
Family Protein kinases, catalytic subunit 0.00000419
Further Details:      
 
Domain Number 2 Region: 729-916
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.33e-50
Family Nucleotide and nucleoside kinases 0.0000000359
Further Details:      
 
Domain Number 3 Region: 606-717
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-31
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 473-573
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-21
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 342-392
Classification Level Classification E-value
Superfamily L27 domain 6.24e-20
Family L27 domain 0.0000864
Further Details:      
 
Domain Number 6 Region: 402-453
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000453
Family L27 domain 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010361   Gene: ENSFCAG00000011147   Transcript: ENSFCAT00000011154
Sequence length 920
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:35955384:36309286:-1 gene:ENSFCAG00000011147 transcript:ENSFCAT00000011154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLK
REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH
YMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV
GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPR
QWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGNWTIRAVSQVLDSLEEIHALT
DCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPE
NNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMD
MENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREING
ISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSV
SDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKL
ENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNADLV
TYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGK
NYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLR
TAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHL
EEAVELVCTAPQWVPVSWVY
Download sequence
Identical sequences ENSFCAP00000010361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]