SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010414 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010414
Domain Number 1 Region: 887-935
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000179
Family Myb/SANT domain 0.007
Further Details:      
 
Domain Number 2 Region: 1010-1034,1078-1105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000036
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010414
Domain Number - Region: 513-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0034
Family Plant C2H2 finger (QALGGH zinc finger) 0.035
Further Details:      
 
Domain Number - Region: 560-569,808-815
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0212
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010414   Gene: ENSFCAG00000011210   Transcript: ENSFCAT00000011215
Sequence length 1197
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:43071182:43107814:-1 gene:ENSFCAG00000011210 transcript:ENSFCAT00000011215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDQQLYKTNHVAHSGENLFYQQPPLGIHGGLNHNYGNTVAGAGMDAPQASPISPHFPQD
TRDGLGLPVGSKNLGQVDTSRQGGWGSHTGPGNHVQLRGGLTNSNMMWGTPAQAEATDGY
QYTYSQASEIRTQKLTSGVLHKLDSFTQVFANQNLRIQVNNMAQVLHTQSAVMDGAPDSA
LRQLLAQKPVEPPAPAIPSRYQQVPQQAHPGFAGGLSKSTLQVGPHPSQGHLYYDYQQPL
AQMPVQGGQPLQAPQMLSQHVPQMQQHQYYPQPQQQQAGQQQMAMQEMQQQQQQQQQQQQ
IRPAQPQQPQQQLQLQQRQGSMQIPQYYPSQPVMQHLQEQQQQQQMHLQPPSYHRDPHPY
APEQAHAVQLIQLGSMPQYYYQEPQQPYSHPLCPQSHLPQHQQREDGQPKTYPSDRQAPA
MLSSHGDLGPPEAGMGDPASSDLNRLSSALPHRPLLSPGGIHLNNMGPQHQQLSPSALWP
QMHLPDGRAQPGSPESSGQPKGVFGEQFDAKNKLTCSICLKEFKSLPALNGHMRSHGGMR
ASPSLKQEEGEKALPPQPQPPLPPPPPPPQLPPEAESLTPMVMPVSVPVKLLPPKPGSQG
FANSIVAAPSTRDKPASSMSDDEMPVLEIPKKHQPAPAKAEEPLRTLPEKKKFRHRPEPL
FIPPPPSYPANPAASYSGATLYQSQLRSPRVLGEHLLLDPAHELPPYTPPPMLSPVRQGS
GLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGPGEQTIDVEPRI
NIGLRFQAEIPELQDVSALARDTHKATLVWKPWPELENHDLQQRVENLLNLCCSSALPGG
GTNSEFALHSLFEAKGDVMAALEMLLLRKPVRLKCHPLANYHYAGSDKWTSLERKLFNKA
LATYSKDFIFVQKMVKSKTVAQCVEYYYTWKKIMRLGRKHRTRLAEIDDSVTSEEEEELE
EEEEDPEEDRKSTREEESEVPKSPEPPPGPVLAPTEGPPLQALGQPSGSFICEMPNCGAV
FSSRQALNGHARIHGGTNQVTKARGAIPSGKQKPGSAQSGYCSVKSSPSHSTTSGETDPT
TIFPCKECGKVFFKIKSRNAHMKTHRQQEEQQRQKAQKAAFAAEMAATIERTTGPAGAPG
LLPLDQLSLIKPIKDVDILDGDVVQQLGGVMEEAEVVDTDLLLDDQDSVLLQGDAEL
Download sequence
Identical sequences ENSFCAP00000010414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]