SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010551 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010551
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.57e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.000000398
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 7.21e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000166
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.27e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010551   Gene: ENSFCAG00000011357   Transcript: ENSFCAT00000011359
Sequence length 368
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:33084952:33090594:-1 gene:ENSFCAG00000011357 transcript:ENSFCAT00000011359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPEVHLASRFVNDACRGLVFGGCVEKSPVSRNPEVPFESSAYCISSSARGKELRLTL
SPLPGAQPPREPLALVFRFGMSGSFQLAPSEALPAHAHLRFYTAPPGPRLALCFVDIRRF
GHWDIGGEWQPGRGPCVLLEYEQFRENVLRNLADKVFDKPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKAREVLEALQQHRPSPELTLSQKIRAKLQNPDLLELCHSVPKEVVQLG
GKGYGPESGEEDFAAFRAWLQCYGMPGMSSLQDGRGRTIWFQGDPGPLAPKGGKSRKKKS
KGAQQGPEHGSEDPLLPSTAPSRTRGAQRGLSEQTTAWQPEGTSLSQDPEVPLVPKKGRR
RGRPKTSG
Download sequence
Identical sequences ENSFCAP00000010551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]