SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010562 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010562
Domain Number 1 Region: 751-979
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-60
Family DBL homology domain (DH-domain) 0.0000000012
Further Details:      
 
Domain Number 2 Region: 347-523
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.07e-56
Family Regulator of G-protein signaling, RGS 0.0000000305
Further Details:      
 
Domain Number 3 Region: 28-118
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-21
Family PDZ domain 0.026
Further Details:      
 
Domain Number 4 Region: 982-1105
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-18
Family Pleckstrin-homology domain (PH domain) 0.0000218
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010562
Domain Number - Region: 147-225
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000115
Family Formin homology 2 domain (FH2 domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010562   Gene: ENSFCAG00000011367   Transcript: ENSFCAT00000011370
Sequence length 1529
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:66166377:66207791:1 gene:ENSFCAG00000011367 transcript:ENSFCAT00000011370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLPCRLSSLSLGDPAPGRRPSSHLRQPSDASDASDTAGLVQRCVIIQKDQHGFGFTVSG
DRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSS
SSSVSVSGLQQDPAPAGAPRVAPTVPPPPPPPPPPPPQHITGPKPLQDPEFQKHATQILR
NMLKQEEKELQRICEVYSRNPASPLEEQMEGARRRVTQLQRKIQQETGGSADLLSLYGDT
GQRSSEGRLSLDSQEGDSGLDSGAERFPSLGEVLKNRNSALSDPGLDSPRTSPVIVARVA
QHHRRQGSDAPVPGASDQGTDQSPKPLIIGPEEDCDPGYFNNESDIIFQDLEKLKARPAH
LGVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKVPEVL
QTEIDSRLRSSEDVRAALREAQEAAMPEIQEQIQDYRTKRTLGLGSLYGENDLLDLDGDP
LRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGLRLREARPSGAAEKAQAAP
DKDKWLPFFPKTKKSSNSKKDKEALEDKRRNPILKYIGKPKGSSQSTFHIPLSPVEVKPG
NVRNIIQHFENNQPYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKR
SRKADNVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESP
NLGFGADALLPHLLEDDLGQLSDLELEPDAQNWQHMVGKDVVAGLSQREIDRQEVINELF
VTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMRKLREEG
PIIKDIGDLMLARFDGPAREELQQVAARFCSHQSIALALIKTKQRKESRFQLFMQEAESH
PQCRRLQLRDLIISEMQRLTKYPLLLESVLKHTEGGTSEHEKLCRARDQCREILKYVNEA
VKQTENRHRLEGYQKRLDTTSLERASNPLAAEFKSLDLTARKMIHEGPLTWRTSKDKTLG
GQLHVLLWSPCRVEGRGFQHLVALAGAAVTALPPPRGPSPFLRTDKRAFFIICTSELGPP
QIYELVALTSSDKNTWMELLEEAVRNATGRPGAAPAPAHPPPTGAQEPAHQSLTPSRVGL
DGSEVFHGEPGPEELSGGPGPQQRVKGKHPVPLEDPEQEGSIEEELGALSHPPAALDAEN
GGRRTRDPILLSLPGPLVMEGLADAALQDVESLRRLILWGLLPGHPAEAQASREPEADRT
PTPSLMSSASQPRDPGSPGPERDQPEQEDTALCSLEHLPPRARNSGIWESPELDRNPEEE
TSNTEAAGSYKVVRKAEVAGATAVPALPESGHSGPEPAEAEGGAEAAGNCFYVSMPAGPP
DSSTDPSGAPTSPAQPDSLPDWQTEPRPRCQGGRRRPSCSPPGLALRDASSIFHTIEQLT
IKLHRLKDMERAHRELLRSLGGDSSGGTTPVGSFHAEAARWTDSSLSPPAKEPLASDSRD
RHQPGLCSEDGSDTPLEECMAHAASCPGL
Download sequence
Identical sequences ENSFCAP00000010562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]