SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010683 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010683
Domain Number 1 Region: 96-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000605
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 142-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000458
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010683   Gene: ENSFCAG00000011501   Transcript: ENSFCAT00000011503
Sequence length 198
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:2773121:2773717:-1 gene:ENSFCAG00000011501 transcript:ENSFCAT00000011503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVLPSPPCPQPLALPSAEAMEAPPSRTGRSPEPGPSSSTGPPQPSSPPRPNHYLLIDTQ
GIPYTVLVDQESEREPGADGASAQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDT
CGKAFKRASHLARHHSIHRAGGGRPHGCPLCPRRFREAGELAQHSRVHSGERPFQCPHCP
RRFMEQNTLQKHTRWKHP
Download sequence
Identical sequences M3WF76
9685.ENSFCAP00000010683 ENSFCAP00000010683 ENSFCAP00000010683 XP_003997440.1.62641 XP_006940889.1.62641 XP_011287855.1.62641 XP_014934518.1.86478 XP_015392381.1.5354 XP_019293341.1.44245 XP_019293342.1.44245 XP_019293343.1.44245 XP_019674656.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]